(data stored in SCRATCH zone)

EMBL: CP002417.PE490

CP002417.PE490       Location/Qualifiers
FT   CDS             530707..531969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0491"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: vap:Vapar_0473 putative RNA methylase; PFAM:
FT                   RNA methylase; THUMP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34713"
FT                   /db_xref="GOA:E6V4G7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G7"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADU34713.1"
FT                   /translation="MESPLVGLPDGQFPVNDLSFFLPCAAGVEEFLAQEVHALTGRVGQ
FT                   DLLTLRGGVRVRADWRDALKLNLHSRLAQRVLVELAHAPYRNENDLYAIASGVAWEIWF
FT                   TPKQTFKIETTAQHSPLQSLNFATLRIKDAIADRFRAKANGVRPSIETQWPDTRVFAHL
FT                   TTEHCTLYIDTSGEPLFKRGWRQDKGDAPLKETLAAAMLAASGWWNPETGTVSEQPLYD
FT                   PCCGSGTIPIEAAQIARGIAAGSLRRFGFEKLLPFQAHVWDAIKKESLLAVKPGSVAIF
FT                   GSDVSHRMVDFAERNAERAGVADAIEFRGGDALQRMPPAEGGVVMLNPPYGERIEVGGV
FT                   ARAGAREAAQTEEGDGSEFFPQLATHWKKNYAGWTAWVLTPDLKLPKQMRLKESRRVPM
FT                   WNGPIECRLFRFDMVAGSARK"
     MESPLVGLPD GQFPVNDLSF FLPCAAGVEE FLAQEVHALT GRVGQDLLTL RGGVRVRADW        60
     RDALKLNLHS RLAQRVLVEL AHAPYRNEND LYAIASGVAW EIWFTPKQTF KIETTAQHSP       120
     LQSLNFATLR IKDAIADRFR AKANGVRPSI ETQWPDTRVF AHLTTEHCTL YIDTSGEPLF       180
     KRGWRQDKGD APLKETLAAA MLAASGWWNP ETGTVSEQPL YDPCCGSGTI PIEAAQIARG       240
     IAAGSLRRFG FEKLLPFQAH VWDAIKKESL LAVKPGSVAI FGSDVSHRMV DFAERNAERA       300
     GVADAIEFRG GDALQRMPPA EGGVVMLNPP YGERIEVGGV ARAGAREAAQ TEEGDGSEFF       360
     PQLATHWKKN YAGWTAWVLT PDLKLPKQMR LKESRRVPMW NGPIECRLFR FDMVAGSARK       420
//

If you have problems or comments...

PBIL Back to PBIL home page