(data stored in ACNUC1104 zone)

EMBL: CP002417.PE491

CP002417.PE491       Location/Qualifiers
FT   CDS             complement(532105..532527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34714"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G8"
FT                   /inference="similar to AA sequence:KEGG:Bpro_1344"
FT                   /protein_id="ADU34714.1"
FT                   /translation="MKRLPLFFLALLASALTRAEWLTLSGTPGDATGSYVQVDPARIEV
FT                   DGARRGVTLRMSLAQDFTGKDGFKLRSFEARVTVDCEARTARYVSATYYGLPNFVGQPV
FT                   AIKQFEDDDIRPMTLPGAPPELAARTVNAACNVGAK"
     MKRLPLFFLA LLASALTRAE WLTLSGTPGD ATGSYVQVDP ARIEVDGARR GVTLRMSLAQ        60
     DFTGKDGFKL RSFEARVTVD CEARTARYVS ATYYGLPNFV GQPVAIKQFE DDDIRPMTLP       120
     GAPPELAART VNAACNVGAK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page