(data stored in ACNUC1104 zone)

EMBL: CP002417.PE492

CP002417.PE492       Location/Qualifiers
FT   CDS             532654..533088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0493"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: vap:Vapar_0474 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34715"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0474"
FT                   /protein_id="ADU34715.1"
FT                   /translation="MTLPQETGLVVIDTNIALDLLVFDNPDCLPLAAALASGALRWIAT
FT                   APMRTELARVLGYPLIARRLAQREMEATRVLEAFDARVSLLTDTPPRAPCVCKDPDDQV
FT                   FIDLAVAQRARLFSKDQAVLTMRKRLAAQGVVVATVLAAA"
     MTLPQETGLV VIDTNIALDL LVFDNPDCLP LAAALASGAL RWIATAPMRT ELARVLGYPL        60
     IARRLAQREM EATRVLEAFD ARVSLLTDTP PRAPCVCKDP DDQVFIDLAV AQRARLFSKD       120
     QAVLTMRKRL AAQGVVVATV LAAA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page