(data stored in ACNUC1104 zone)

EMBL: CP002417.PE495

CP002417.PE495       Location/Qualifiers
FT   CDS             534867..536780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hna:Hneap_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34718"
FT                   /db_xref="GOA:E6V4H2"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H2"
FT                   /inference="similar to AA sequence:KEGG:Hneap_2318"
FT                   /protein_id="ADU34718.1"
FT                   /translation="MPPAAASLPLATAGASARRRRQSGQAIVYLVAMLPIIFLSVLVVY
FT                   NTATAAREKMKLQNTADAATYSANVLTARTLNYLAYTNRAMAANEASVATLASVQTSMA
FT                   MLITSAANIQEGLVVAEAMKGIRNLERARLPVVGPIFALAWLLGNVPRANRLQRTADRI
FT                   AGFVEPSAKPLQIGADILRAFNQGISASQAVMLLGTTAQLPQLVKDVVNSNDPDASVPP
FT                   TETAIFVIKFVADVGTYLKTYHQSGSLGFDDEEFNEVLRFAHAAQATRDDWTKNRRFLP
FT                   NVLGWVASGMSGALQGMVSSSPNSPPGFSDITGDMMGGLLEWKGGTELVATEGIVGDET
FT                   GRIRWQSADSIEIKLPIGVLYTDLIGGWDDILRGRFGLGAGAAAAGGPNYMKSWEGQRL
FT                   TLRSYAREGRTYGGLNGEVGDTAYMERESFERAARDRNGELLLAPMAVLVFNAKLHYSP
FT                   RTDIGIVTKSWAMPRFTEIKDHPPMVANESDNWLKENGFSGANPLKWGKNTDKGPAFTL
FT                   VVQKGGDKVRTGEVAGFGNSAADGKAGLRDNFQGREIKALSTSQVYFRRPQDRWARRDN
FT                   AVADPSTVGKYNVGFAGGYIEHRSLFSPYWHVHNVEPSLWARAIAMGGAAVGGSADEDN
FT                   GN"
     MPPAAASLPL ATAGASARRR RQSGQAIVYL VAMLPIIFLS VLVVYNTATA AREKMKLQNT        60
     ADAATYSANV LTARTLNYLA YTNRAMAANE ASVATLASVQ TSMAMLITSA ANIQEGLVVA       120
     EAMKGIRNLE RARLPVVGPI FALAWLLGNV PRANRLQRTA DRIAGFVEPS AKPLQIGADI       180
     LRAFNQGISA SQAVMLLGTT AQLPQLVKDV VNSNDPDASV PPTETAIFVI KFVADVGTYL       240
     KTYHQSGSLG FDDEEFNEVL RFAHAAQATR DDWTKNRRFL PNVLGWVASG MSGALQGMVS       300
     SSPNSPPGFS DITGDMMGGL LEWKGGTELV ATEGIVGDET GRIRWQSADS IEIKLPIGVL       360
     YTDLIGGWDD ILRGRFGLGA GAAAAGGPNY MKSWEGQRLT LRSYAREGRT YGGLNGEVGD       420
     TAYMERESFE RAARDRNGEL LLAPMAVLVF NAKLHYSPRT DIGIVTKSWA MPRFTEIKDH       480
     PPMVANESDN WLKENGFSGA NPLKWGKNTD KGPAFTLVVQ KGGDKVRTGE VAGFGNSAAD       540
     GKAGLRDNFQ GREIKALSTS QVYFRRPQDR WARRDNAVAD PSTVGKYNVG FAGGYIEHRS       600
     LFSPYWHVHN VEPSLWARAI AMGGAAVGGS ADEDNGN                                637
//

If you have problems or comments...

PBIL Back to PBIL home page