(data stored in ACNUC1104 zone)

EMBL: CP002417.PE5

CP002417.PE5         Location/Qualifiers
FT   CDS             complement(6779..7039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34228"
FT                   /db_xref="GOA:E6UXN4"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXN4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0005"
FT                   /protein_id="ADU34228.1"
FT                   /translation="MTIQSTINEFKRVDAQRADFPGEHLAVLGAGVLLLLISGRSRSFI
FT                   ARLVAGAAGGALIGRAASGTGGIARVAAAMQGRGQPGRVKS"
     MTIQSTINEF KRVDAQRADF PGEHLAVLGA GVLLLLISGR SRSFIARLVA GAAGGALIGR        60
     AASGTGGIAR VAAAMQGRGQ PGRVKS                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page