(data stored in ACNUC1104 zone)

EMBL: CP002417.PE50

CP002417.PE50        Location/Qualifiers
FT   CDS             52422..54380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0050"
FT                   /product="glucose inhibited division protein A"
FT                   /note="KEGG: vap:Vapar_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA;
FT                   TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34273"
FT                   /db_xref="GOA:E6UXS9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS9"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ADU34273.1"
FT                   /translation="MLYPEEFDVIVVGGGHAGTEAALAAARMGAKTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KAAIRHRLENQPNLSLFQQAVDDLMVEGDRVVGAVTQVGIAFRARTVVLTAGTFLDGRI
FT                   HVGLDNYQAGRAGDPPAISLSARLKELKLPQGRLKTGTPPRLDGRSIDFSKCTEQPGDG
FT                   MPGGAGPMPVFSFMGRADMHPRQMACWITHTNARTHDIIRSGFDRSPMFTGKIDGVGPR
FT                   YCPSVEDKINRFADKESHQIFLEPEGLTTNEYYPNGISTSLPFDIQYQLVRSMPGLENA
FT                   HILRPGYAIEYDYFDPRELKSSFETRSVKGLFFAGQINGTTGYEEAAAQGLFAGINAAL
FT                   QCRGEDAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEAG
FT                   RKLGLVDDARWDAFSRKRDAVSRETERLKSIWVNPRNLPAAESERVLGKAIEHEYNLAD
FT                   LLRRPDVNYETLMSLDGGKYSASSALSETEIEQIEISAKYSGYIERQHDEVERAAHFEN
FT                   LRLPADFDYGQVKALSFEVRQKLDKHRPETLGLASRISGVTPAAISLLMIHLRKGGHKA
FT                   FARDAATEAAAEPQSAE"
     MLYPEEFDVI VVGGGHAGTE AALAAARMGA KTLLLSHNIE TLGQMSCNPS IGGIGKGHLV        60
     KEVDALGGAM AIATDEAGIQ FRILNSSKGP AVRATRAQAD RVLYKAAIRH RLENQPNLSL       120
     FQQAVDDLMV EGDRVVGAVT QVGIAFRART VVLTAGTFLD GRIHVGLDNY QAGRAGDPPA       180
     ISLSARLKEL KLPQGRLKTG TPPRLDGRSI DFSKCTEQPG DGMPGGAGPM PVFSFMGRAD       240
     MHPRQMACWI THTNARTHDI IRSGFDRSPM FTGKIDGVGP RYCPSVEDKI NRFADKESHQ       300
     IFLEPEGLTT NEYYPNGIST SLPFDIQYQL VRSMPGLENA HILRPGYAIE YDYFDPRELK       360
     SSFETRSVKG LFFAGQINGT TGYEEAAAQG LFAGINAALQ CRGEDAWLPR RDEAYLGVLV       420
     DDLITKGVTE PYRMFTSRAE FRLQLREDNA DMRLTEAGRK LGLVDDARWD AFSRKRDAVS       480
     RETERLKSIW VNPRNLPAAE SERVLGKAIE HEYNLADLLR RPDVNYETLM SLDGGKYSAS       540
     SALSETEIEQ IEISAKYSGY IERQHDEVER AAHFENLRLP ADFDYGQVKA LSFEVRQKLD       600
     KHRPETLGLA SRISGVTPAA ISLLMIHLRK GGHKAFARDA ATEAAAEPQS AE               652
//

If you have problems or comments...

PBIL Back to PBIL home page