(data stored in SCRATCH zone)

EMBL: CP002417.PE501

CP002417.PE501       Location/Qualifiers
FT   CDS             541388..543031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0502"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: hna:Hneap_2309 FHA domain containing protein;
FT                   PFAM: type II secretion system protein E;
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34724"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADU34724.1"
FT                   /translation="MHKVFVNSPQQVVREVPIDVAELQVGKDAGNHIVLSGWNVAKLHA
FT                   QFVLHDEEVFVQDLGSLFGTWVDGNRVTRFGPMKGGEEIIIGGHTLVVSLDVALKPAGA
FT                   DPQEAAEAAQYAEAALAIEDPLLQWRRSLHRTLLQQLDNRRIDTAQMKDEELRSNIRAL
FT                   IAEVIRDTRDMPPELDRALLSQQLLDEAIGLGPLEVLLKDESVTEVMVNRFDEIWIERA
FT                   GRLERTNVAFTSNIAVLGAIERIVTPLGRRIDESSPMVDARLKDGSRVNAIIPPLALRG
FT                   PSVTIRKFPKNRMGHEGMIRTGSITAQMVDFMRIAVEEKLNIIVSGGTGTGKTTLLNMV
FT                   SNFIPPNERIVTIEDAAELSLGQPNLVSLESRPANIEGKGAIAIRDLVRNSLRMRPDRI
FT                   VVGECRGGEALDMLQAMNTGHDGSLTTLHSNSPRDAMSRLEVLVTMAGMNIPVAAIREQ
FT                   IASAVDLIVQLTRFPCGSRKVTQITEITGFADGMIQMQDVYAFRKTGVDDSFKTIGHFT
FT                   AAGTVPEFFTRLQEHGLKLDLEYLFGETTA"
     MHKVFVNSPQ QVVREVPIDV AELQVGKDAG NHIVLSGWNV AKLHAQFVLH DEEVFVQDLG        60
     SLFGTWVDGN RVTRFGPMKG GEEIIIGGHT LVVSLDVALK PAGADPQEAA EAAQYAEAAL       120
     AIEDPLLQWR RSLHRTLLQQ LDNRRIDTAQ MKDEELRSNI RALIAEVIRD TRDMPPELDR       180
     ALLSQQLLDE AIGLGPLEVL LKDESVTEVM VNRFDEIWIE RAGRLERTNV AFTSNIAVLG       240
     AIERIVTPLG RRIDESSPMV DARLKDGSRV NAIIPPLALR GPSVTIRKFP KNRMGHEGMI       300
     RTGSITAQMV DFMRIAVEEK LNIIVSGGTG TGKTTLLNMV SNFIPPNERI VTIEDAAELS       360
     LGQPNLVSLE SRPANIEGKG AIAIRDLVRN SLRMRPDRIV VGECRGGEAL DMLQAMNTGH       420
     DGSLTTLHSN SPRDAMSRLE VLVTMAGMNI PVAAIREQIA SAVDLIVQLT RFPCGSRKVT       480
     QITEITGFAD GMIQMQDVYA FRKTGVDDSF KTIGHFTAAG TVPEFFTRLQ EHGLKLDLEY       540
     LFGETTA                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page