(data stored in ACNUC1104 zone)

EMBL: CP002417.PE506

CP002417.PE506       Location/Qualifiers
FT   CDS             complement(548661..549563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34729"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0477"
FT                   /protein_id="ADU34729.1"
FT                   /translation="MNPLRRGASTRLHSAKGAASAPAPLDALPNTPAPGDYAEFLRVTL
FT                   PKQEKNVASHRLGSERVWLKKAGPRHGKWGYRVMAAVARMVRLDIIKPVPNPGGEAAIA
FT                   TEARRLKQLAAAGLRVPTVLAQQPDGLLISDLGESGRATVVLQERLDQAAAAGPAALLA
FT                   VWREGLAAIAAVHVRGQHLSQAFDRNLVQCPDGVIGYIDFEDDPAEVMTLAECQARDWL
FT                   SYLHSTAMMLEAAAPQAAGQHWHAALATVNEEVRERIANAARRMKWARKLPASRRWGRD
FT                   TQRVRAVARLLGRWHDAAA"
     MNPLRRGAST RLHSAKGAAS APAPLDALPN TPAPGDYAEF LRVTLPKQEK NVASHRLGSE        60
     RVWLKKAGPR HGKWGYRVMA AVARMVRLDI IKPVPNPGGE AAIATEARRL KQLAAAGLRV       120
     PTVLAQQPDG LLISDLGESG RATVVLQERL DQAAAAGPAA LLAVWREGLA AIAAVHVRGQ       180
     HLSQAFDRNL VQCPDGVIGY IDFEDDPAEV MTLAECQARD WLSYLHSTAM MLEAAAPQAA       240
     GQHWHAALAT VNEEVRERIA NAARRMKWAR KLPASRRWGR DTQRVRAVAR LLGRWHDAAA       300
//

If you have problems or comments...

PBIL Back to PBIL home page