(data stored in ACNUC1104 zone)

EMBL: CP002417.PE507

CP002417.PE507       Location/Qualifiers
FT   CDS             complement(549628..551325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0509"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   vap:Vapar_0478 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34730"
FT                   /db_xref="GOA:E6V4I4"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4I4"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADU34730.1"
FT                   /translation="MPTIIPFPARYSAFALCVVGLVACLAFVLVSPHLWLAWIGVAVFA
FT                   VLSGTGIHDLRQPRHAILRNYPVIGHLRFLLEFIRPEMRQYFIESDSEAAPFSRAQRSL
FT                   VYQRAKGEPDNRPFGTQLNVTIAGYEWINHSMQPTKLANHDFRIVIGGTPQPTDGNSAQ
FT                   VCTQPYSASVFNISAMSFGALSANAILALNQGAKMGGFAHDTGEGSISQHHRVHGGDLI
FT                   WEIGSGYFGCRNDDGSFNAERFTANARDPQVKMIEIKLSQGAKPGHGGVLPAPKVTPEI
FT                   AAARGVPVGVDCISPSSHSAFSTPTEMMHFVAKLRELSGGKPTGFKFCLGHPWEWFGIV
FT                   KAMQATGITPDFIVVDGAEGGTGAAPVEFSDHVGAPLQEGLLLVHNTLIGVNLRHRIKI
FT                   GCAAKVITAFDVARMMALGADWCNAARGFMMALGCIQAQSCHTGHCPTGVTTQDPLRQQ
FT                   ALVVPTKADRVRNFHRSTLHALQELVQAAGLDHPQQITAHHIVRRISDTEVRLLSNLVM
FT                   QVQPGALLGPLDAQHNVFRTYWPLASAESFQPVTQSPQGLVPGFAMAA"
     MPTIIPFPAR YSAFALCVVG LVACLAFVLV SPHLWLAWIG VAVFAVLSGT GIHDLRQPRH        60
     AILRNYPVIG HLRFLLEFIR PEMRQYFIES DSEAAPFSRA QRSLVYQRAK GEPDNRPFGT       120
     QLNVTIAGYE WINHSMQPTK LANHDFRIVI GGTPQPTDGN SAQVCTQPYS ASVFNISAMS       180
     FGALSANAIL ALNQGAKMGG FAHDTGEGSI SQHHRVHGGD LIWEIGSGYF GCRNDDGSFN       240
     AERFTANARD PQVKMIEIKL SQGAKPGHGG VLPAPKVTPE IAAARGVPVG VDCISPSSHS       300
     AFSTPTEMMH FVAKLRELSG GKPTGFKFCL GHPWEWFGIV KAMQATGITP DFIVVDGAEG       360
     GTGAAPVEFS DHVGAPLQEG LLLVHNTLIG VNLRHRIKIG CAAKVITAFD VARMMALGAD       420
     WCNAARGFMM ALGCIQAQSC HTGHCPTGVT TQDPLRQQAL VVPTKADRVR NFHRSTLHAL       480
     QELVQAAGLD HPQQITAHHI VRRISDTEVR LLSNLVMQVQ PGALLGPLDA QHNVFRTYWP       540
     LASAESFQPV TQSPQGLVPG FAMAA                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page