(data stored in SCRATCH zone)

EMBL: CP002417.PE508

CP002417.PE508       Location/Qualifiers
FT   CDS             551382..552179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0510"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   vap:Vapar_0479 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34731"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C5"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADU34731.1"
FT                   /translation="MTTSPPTPETPQIPAAPAQEPLGPDDFDALDTALDAMREHDEEIP
FT                   QWEFCEGFMAALICTRRSIEPTEYWPVLLGDSFVPAQHMEFVWNWKRRWREIEEGLDAP
FT                   VETLDDERSWQPEVLDTRGAIASLPEEERAEVAGEAIPSFAQVWALGFMYAVENWPEDW
FT                   ATPRDKDAAQMLDDALDNIVALTEDDKAKPTVSMYSEDGPPSVSQQRLDDFGAAIWAVY
FT                   DLRQLWKSLGPKVETIRKEATPGRNDPCPCGSGKKYKKCHGAA"
     MTTSPPTPET PQIPAAPAQE PLGPDDFDAL DTALDAMREH DEEIPQWEFC EGFMAALICT        60
     RRSIEPTEYW PVLLGDSFVP AQHMEFVWNW KRRWREIEEG LDAPVETLDD ERSWQPEVLD       120
     TRGAIASLPE EERAEVAGEA IPSFAQVWAL GFMYAVENWP EDWATPRDKD AAQMLDDALD       180
     NIVALTEDDK AKPTVSMYSE DGPPSVSQQR LDDFGAAIWA VYDLRQLWKS LGPKVETIRK       240
     EATPGRNDPC PCGSGKKYKK CHGAA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page