(data stored in ACNUC1104 zone)

EMBL: CP002417.PE51

CP002417.PE51        Location/Qualifiers
FT   CDS             54377..55018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0051"
FT                   /product="methyltransferase GidB"
FT                   /note="KEGG: vap:Vapar_0046 16S rRNA methyltransferase
FT                   GidB; TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34274"
FT                   /db_xref="GOA:E6UXT0"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT0"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ADU34274.1"
FT                   /translation="MSAPIDTLRAGAGALGVTLSDRQGEQLLAYGTLMLKWNKVYNLTA
FT                   VRDPAGVMTHHLLDSLAVIAPLQRQYPEQGRLLDVGSGAGLPGVIIAIMRPDIDVSCLD
FT                   AVAKKAAFVQQVAVELELPNLRGLHARVELLEGSYNVISSRAFASLPDFFNGSKHLLPA
FT                   DGVWLAMKGKMPGDELAVLPPEVAVFHVEQLTVPGLDAERCIVWARKASV"
     MSAPIDTLRA GAGALGVTLS DRQGEQLLAY GTLMLKWNKV YNLTAVRDPA GVMTHHLLDS        60
     LAVIAPLQRQ YPEQGRLLDV GSGAGLPGVI IAIMRPDIDV SCLDAVAKKA AFVQQVAVEL       120
     ELPNLRGLHA RVELLEGSYN VISSRAFASL PDFFNGSKHL LPADGVWLAM KGKMPGDELA       180
     VLPPEVAVFH VEQLTVPGLD AERCIVWARK ASV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page