(data stored in ACNUC1104 zone)

EMBL: CP002417.PE510

CP002417.PE510       Location/Qualifiers
FT   CDS             complement(553406..553720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0512"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0481 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34733"
FT                   /db_xref="GOA:E6V5C7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34733.1"
FT                   /translation="MSNNDIVFTSNEAAHRYEAAIDGKLAGYAEYNLLTDAIMFTHTEV
FT                   LPEFEGKGVGSGIAKHVLGEARTKGLHVIPVCQFIAGYIRKHREYADLVRPDIQRAFKI
FT                   "
     MSNNDIVFTS NEAAHRYEAA IDGKLAGYAE YNLLTDAIMF THTEVLPEFE GKGVGSGIAK        60
     HVLGEARTKG LHVIPVCQFI AGYIRKHREY ADLVRPDIQR AFKI                        104
//

If you have problems or comments...

PBIL Back to PBIL home page