(data stored in ACNUC1104 zone)

EMBL: CP002417.PE511

CP002417.PE511       Location/Qualifiers
FT   CDS             complement(553717..554214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34734"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0482"
FT                   /protein_id="ADU34734.1"
FT                   /translation="MTAATNAQTIERFYSAFAKLDAATMEACYAPDAVFDDEAFSLRGR
FT                   REVGGMWRMLAGATKAKGADVWRLTFRDVQADDTTGSAHWDAHYRFSATGRLVDNSVDA
FT                   RFTFTPEGLIATHRDTFPFWTWSRQALGTPGLLLGWTPMLRNKVRATAAGNLSKFLSSQ
FT                   PS"
     MTAATNAQTI ERFYSAFAKL DAATMEACYA PDAVFDDEAF SLRGRREVGG MWRMLAGATK        60
     AKGADVWRLT FRDVQADDTT GSAHWDAHYR FSATGRLVDN SVDARFTFTP EGLIATHRDT       120
     FPFWTWSRQA LGTPGLLLGW TPMLRNKVRA TAAGNLSKFL SSQPS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page