(data stored in ACNUC1104 zone)

EMBL: CP002417.PE512

CP002417.PE512       Location/Qualifiers
FT   CDS             complement(554249..555145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0514"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rfr:Rfer_3491 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34735"
FT                   /db_xref="GOA:E6V5C9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5C9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34735.1"
FT                   /translation="MGLDSNLDFDWRLVRAFLAALDHGSLLAASRALGSSQPTLGRHIA
FT                   ELETQLGVVLFERTGRGLRPTAMAARLAESARAMESGAVSLSRSVSGANAATAGTVRIS
FT                   ASQATARQMLPALLVRMRQELPEIQVELVSTNEVSNLLRREADIAIRMTEPTTATVVAR
FT                   RIGRFALGAFAQADYLRRRGTPRQTADLLRHDVLGYDRIDTIVRMSAQLGTPLQREDFC
FT                   FRTDDMGAYWEALRQGMGIGFVSESLARTDSQVQRVLPQLKIPSLPVWLAVHREIRTDR
FT                   RIRAVYDFLARNIPASI"
     MGLDSNLDFD WRLVRAFLAA LDHGSLLAAS RALGSSQPTL GRHIAELETQ LGVVLFERTG        60
     RGLRPTAMAA RLAESARAME SGAVSLSRSV SGANAATAGT VRISASQATA RQMLPALLVR       120
     MRQELPEIQV ELVSTNEVSN LLRREADIAI RMTEPTTATV VARRIGRFAL GAFAQADYLR       180
     RRGTPRQTAD LLRHDVLGYD RIDTIVRMSA QLGTPLQRED FCFRTDDMGA YWEALRQGMG       240
     IGFVSESLAR TDSQVQRVLP QLKIPSLPVW LAVHREIRTD RRIRAVYDFL ARNIPASI         298
//

If you have problems or comments...

PBIL Back to PBIL home page