(data stored in SCRATCH zone)

EMBL: CP002417.PE514

CP002417.PE514       Location/Qualifiers
FT   CDS             complement(556545..557072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0516"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: vap:Vapar_0483 CinA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34737"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D1"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADU34737.1"
FT                   /translation="MDSSFSSTLSSPLPDQDTPALVAAVAERLLQKGWMLSTAESCTGG
FT                   LIAAACTELAGSSAWFERGFITYSNAAKTELLGVDAASIDAHGAVSEPVARAMALGAIA
FT                   RSAPSRAAIAVTGIAGPTGGTPEKPVGTVWFGWCVDGQIRTERRRFDGDRATVRAATVH
FT                   YALQTLVTLLTE"
     MDSSFSSTLS SPLPDQDTPA LVAAVAERLL QKGWMLSTAE SCTGGLIAAA CTELAGSSAW        60
     FERGFITYSN AAKTELLGVD AASIDAHGAV SEPVARAMAL GAIARSAPSR AAIAVTGIAG       120
     PTGGTPEKPV GTVWFGWCVD GQIRTERRRF DGDRATVRAA TVHYALQTLV TLLTE            175
//

If you have problems or comments...

PBIL Back to PBIL home page