(data stored in ACNUC1104 zone)

EMBL: CP002417.PE515

CP002417.PE515       Location/Qualifiers
FT   CDS             complement(557078..557665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0517"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="KEGG: vap:Vapar_0484 phosphatidylglycerophosphatase
FT                   A; manually curated; PFAM: phosphatidylglycerophosphatase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34738"
FT                   /db_xref="GOA:E6V5D2"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D2"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADU34738.1"
FT                   /translation="MQAASPSSSSHATASGAMPQPSIRRPTLRFLFGHPAHAIALGFGS
FT                   GLPRFAPGTVGTLWAWVAFAVMQLWFTPATIGWIILASLPIGWWACTVTARDMNIADPG
FT                   AIVWDEVVAFWIVLWLVTPAGLFAQAIAFGLFRFFDAAKPGPVAWADGLFKQRDAVQTS
FT                   QVRWWHAGFGIILDDLVAAFCTLLVIALWRAW"
     MQAASPSSSS HATASGAMPQ PSIRRPTLRF LFGHPAHAIA LGFGSGLPRF APGTVGTLWA        60
     WVAFAVMQLW FTPATIGWII LASLPIGWWA CTVTARDMNI ADPGAIVWDE VVAFWIVLWL       120
     VTPAGLFAQA IAFGLFRFFD AAKPGPVAWA DGLFKQRDAV QTSQVRWWHA GFGIILDDLV       180
     AAFCTLLVIA LWRAW                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page