(data stored in SCRATCH zone)

EMBL: CP002417.PE518

CP002417.PE518       Location/Qualifiers
FT   CDS             complement(561022..562029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bll0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34741"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D5"
FT                   /inference="similar to AA sequence:KEGG:bll0408"
FT                   /protein_id="ADU34741.1"
FT                   /translation="MTASIARTAPSLRRQLLLATAFTLLAGTALAQAPAADFPSHPIRM
FT                   VVTFPPGGSADAVVRMLVPRLNEKLGQQVVVDNRPGAGGNVGLTLVAKAPADGYTLGLG
FT                   AAGALTANVNLYPQMPFDPVKDFKPVGMVAATPFVIVGHPSIGARTLRELIALAKAKPG
FT                   TLSMGHGGNGTAMHLSTALFAQMADVKLIEVPYRGSGPAALDAIAGQVQLALVDLPASL
FT                   QQIRAGKLIAFGVTSAQRVPMLPDVPTVAEAGLPGYDSTGWFGVVAPAGTPAPIVARLN
FT                   AELNAALGDEQIKASMRNLGAEPAPTSTEAFEAYIRSETKKWAKVIQVANIKLD"
     MTASIARTAP SLRRQLLLAT AFTLLAGTAL AQAPAADFPS HPIRMVVTFP PGGSADAVVR        60
     MLVPRLNEKL GQQVVVDNRP GAGGNVGLTL VAKAPADGYT LGLGAAGALT ANVNLYPQMP       120
     FDPVKDFKPV GMVAATPFVI VGHPSIGART LRELIALAKA KPGTLSMGHG GNGTAMHLST       180
     ALFAQMADVK LIEVPYRGSG PAALDAIAGQ VQLALVDLPA SLQQIRAGKL IAFGVTSAQR       240
     VPMLPDVPTV AEAGLPGYDS TGWFGVVAPA GTPAPIVARL NAELNAALGD EQIKASMRNL       300
     GAEPAPTSTE AFEAYIRSET KKWAKVIQVA NIKLD                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page