(data stored in ACNUC1104 zone)

EMBL: CP002417.PE519

CP002417.PE519       Location/Qualifiers
FT   CDS             562132..563040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0521"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbr:BB0712 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34742"
FT                   /db_xref="GOA:E6V5D6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34742.1"
FT                   /translation="MNENFSPTFSPTIRQLRAFLAVHQLRKLSAAAQRLFVTQSAVSML
FT                   IRQLEEGLGTRLFDRTTRSLKPTAAANEMLPVAERILRDVDSLSTGFRELTTLERGRVS
FT                   VAITPTLATFLLPDAIRSFSQEHPKVRVLVNDCAPDQFISRILGEHVDFGIGTPERPGA
FT                   EVEVERLMRDHLALVCRDDHPLAKARVVRWTDLAGHPLITVRAGYGVRPLIDGTAADAG
FT                   VALDVVNEVSFLSSAIWMTAIGMGASIMPSAFARAANDPSLVVKVLSAPRVSRDISLVI
FT                   KRGHSLSVAARAFIAALKKSL"
     MNENFSPTFS PTIRQLRAFL AVHQLRKLSA AAQRLFVTQS AVSMLIRQLE EGLGTRLFDR        60
     TTRSLKPTAA ANEMLPVAER ILRDVDSLST GFRELTTLER GRVSVAITPT LATFLLPDAI       120
     RSFSQEHPKV RVLVNDCAPD QFISRILGEH VDFGIGTPER PGAEVEVERL MRDHLALVCR       180
     DDHPLAKARV VRWTDLAGHP LITVRAGYGV RPLIDGTAAD AGVALDVVNE VSFLSSAIWM       240
     TAIGMGASIM PSAFARAAND PSLVVKVLSA PRVSRDISLV IKRGHSLSVA ARAFIAALKK       300
     SL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page