(data stored in SCRATCH zone)

EMBL: CP002417.PE520

CP002417.PE520       Location/Qualifiers
FT   CDS             563142..563849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0522"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: vap:Vapar_0486 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34743"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D7"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0486"
FT                   /protein_id="ADU34743.1"
FT                   /translation="MKNIVRLGVLGLCLAFSFMLAACGNKEAEQRTAFIEFLQTRVLDK
FT                   PGLRVPSPSEEQKKSFGDYAQHYAVITDFTEGMNKSVSQPMGEVMAKGALRSIGDLATR
FT                   RDDLKAAKEGLAGLRTALDQQLAKADAARAQLKQPEDLKQVYDKAYEKTVSTPAATFKE
FT                   VFPALDTTFDGALAVGEFLQQNKSKIQISGASVTVTDPAVQAELNKMLQNLNGQSAAIN
FT                   AAQRKMQAVVRGS"
     MKNIVRLGVL GLCLAFSFML AACGNKEAEQ RTAFIEFLQT RVLDKPGLRV PSPSEEQKKS        60
     FGDYAQHYAV ITDFTEGMNK SVSQPMGEVM AKGALRSIGD LATRRDDLKA AKEGLAGLRT       120
     ALDQQLAKAD AARAQLKQPE DLKQVYDKAY EKTVSTPAAT FKEVFPALDT TFDGALAVGE       180
     FLQQNKSKIQ ISGASVTVTD PAVQAELNKM LQNLNGQSAA INAAQRKMQA VVRGS            235
//

If you have problems or comments...

PBIL Back to PBIL home page