(data stored in ACNUC1104 zone)

EMBL: CP002417.PE521

CP002417.PE521       Location/Qualifiers
FT   CDS             complement(563850..564809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0523"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; KEGG:
FT                   vap:Vapar_0487 thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34744"
FT                   /db_xref="GOA:E6V5D8"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D8"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADU34744.1"
FT                   /translation="MGEFDLITRYFKRPAKRSPLGVGDDCALLAPAPGMQLAVSSDMLV
FT                   EGRHFLSTVEPSRLGHKALAVNLSDLAACGAKPLAFTLALALPGVDEHWLEGFSRGLFA
FT                   LADEHGCELVGGDTTRGPLNICITVFGEVPAGSALLRSGARAGDDIWVSGTLGDARLAL
FT                   EVFRGTIALPADVFAQARMRMEQPTPRVTLGQALRGIASSAVDVSDGLVGDLGHILGSS
FT                   NVGATLDVDAAVGTVAAAGTSALSVEMLRTCALSGGDDYELVFTAPSSARAAVEQAGKD
FT                   SATRVTRIGRIDAEAGLRIADASGAPVAQRFGSFDHFV"
     MGEFDLITRY FKRPAKRSPL GVGDDCALLA PAPGMQLAVS SDMLVEGRHF LSTVEPSRLG        60
     HKALAVNLSD LAACGAKPLA FTLALALPGV DEHWLEGFSR GLFALADEHG CELVGGDTTR       120
     GPLNICITVF GEVPAGSALL RSGARAGDDI WVSGTLGDAR LALEVFRGTI ALPADVFAQA       180
     RMRMEQPTPR VTLGQALRGI ASSAVDVSDG LVGDLGHILG SSNVGATLDV DAAVGTVAAA       240
     GTSALSVEML RTCALSGGDD YELVFTAPSS ARAAVEQAGK DSATRVTRIG RIDAEAGLRI       300
     ADASGAPVAQ RFGSFDHFV                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page