(data stored in ACNUC1104 zone)

EMBL: CP002417.PE522

CP002417.PE522       Location/Qualifiers
FT   CDS             complement(564956..566164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0524"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   vap:Vapar_0490 carboxylate-amine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34745"
FT                   /db_xref="GOA:E6V5D9"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5D9"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADU34745.1"
FT                   /translation="MSTALQTPIDPDSDDVRSAPLAADPDSRAVKLEPFNKSEALSLGV
FT                   ELELQLVNTHDYDLAPYAEDMLRLMAQTPLPGSVVPEMTSSMIEISTDICHSAADVIKQ
FT                   LSPIREALIKNADKLNIAVVGGGTHAFQQWHERRIYDKPRFRELSELYGYLSKQFTIFG
FT                   QHVHIGCPDADAALLMLHRMSRYIPHFIALSASSPFVQGQDTQFDSARLNSVFAFPLSG
FT                   RAPFTTSWKEFEAYFERMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERAAA
FT                   LAGYVQSLAAWFLQEQPFEPSEDDYLVYTYNRFQACRFGLDAVYVDPASGQHMPLRDHI
FT                   LMTMTQLEWHSEALNATQALGELRTSVEANRNDARWLREKQGKERLLAEVVRQAALRFR
FT                   GAA"
     MSTALQTPID PDSDDVRSAP LAADPDSRAV KLEPFNKSEA LSLGVELELQ LVNTHDYDLA        60
     PYAEDMLRLM AQTPLPGSVV PEMTSSMIEI STDICHSAAD VIKQLSPIRE ALIKNADKLN       120
     IAVVGGGTHA FQQWHERRIY DKPRFRELSE LYGYLSKQFT IFGQHVHIGC PDADAALLML       180
     HRMSRYIPHF IALSASSPFV QGQDTQFDSA RLNSVFAFPL SGRAPFTTSW KEFEAYFERM       240
     TRTGVVRSMK DFYWDIRPKP EFGTIEIRVF DTPLTVERAA ALAGYVQSLA AWFLQEQPFE       300
     PSEDDYLVYT YNRFQACRFG LDAVYVDPAS GQHMPLRDHI LMTMTQLEWH SEALNATQAL       360
     GELRTSVEAN RNDARWLREK QGKERLLAEV VRQAALRFRG AA                          402
//

If you have problems or comments...

PBIL Back to PBIL home page