(data stored in ACNUC1104 zone)

EMBL: CP002417.PE523

CP002417.PE523       Location/Qualifiers
FT   CDS             complement(566161..567432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0525"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG:
FT                   vap:Vapar_0491 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34746"
FT                   /db_xref="GOA:E6V5E0"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E0"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADU34746.1"
FT                   /translation="MNLTSFINDLLGFWSEWVRPSAGLPTVLWSLLLAAAAASGHLVQR
FT                   YLGLPKVIGYSLVGAVVGFAGFEGAIWPLRGISLFLLELGVAVVLFEAGGRLPLRWFRH
FT                   NPMVLVQSLLEATLTYFGVYWVLTLLGLPEPVANPIALMAIVASPAVLSRVIIDTRAAG
FT                   PVTERAMTLATLNTFYALALGYAQAGLIERAPQTMLQKLYPVAVVLGLSFVVGALMALA
FT                   LRSALRVMSPTSENTSILLLAIIAAGAALTAHVGGSAPLAALIGGVLLKTLNPKPWAWQ
FT                   RQLGTAASLLTMLMFVLVSIVAAQADWTLPVASVVLAVIGVRMIAKISGVAIANPGSGA
FT                   SWKQAFWVGCAMSPLSSIALLIASNFATASPLLGTMITQVALPSILLMEVVGAVLATVA
FT                   IHAVGESSVPWAPQAFSTTEDTQR"
     MNLTSFINDL LGFWSEWVRP SAGLPTVLWS LLLAAAAASG HLVQRYLGLP KVIGYSLVGA        60
     VVGFAGFEGA IWPLRGISLF LLELGVAVVL FEAGGRLPLR WFRHNPMVLV QSLLEATLTY       120
     FGVYWVLTLL GLPEPVANPI ALMAIVASPA VLSRVIIDTR AAGPVTERAM TLATLNTFYA       180
     LALGYAQAGL IERAPQTMLQ KLYPVAVVLG LSFVVGALMA LALRSALRVM SPTSENTSIL       240
     LLAIIAAGAA LTAHVGGSAP LAALIGGVLL KTLNPKPWAW QRQLGTAASL LTMLMFVLVS       300
     IVAAQADWTL PVASVVLAVI GVRMIAKISG VAIANPGSGA SWKQAFWVGC AMSPLSSIAL       360
     LIASNFATAS PLLGTMITQV ALPSILLMEV VGAVLATVAI HAVGESSVPW APQAFSTTED       420
     TQR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page