(data stored in ACNUC1104 zone)

EMBL: CP002417.PE524

CP002417.PE524       Location/Qualifiers
FT   CDS             complement(567429..569411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0526"
FT                   /product="site-specific recombinase Gcr"
FT                   /note="PFAM: site-specific recombinase Gcr; KEGG:
FT                   vap:Vapar_0492 putative site-specific recombinase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34747"
FT                   /db_xref="GOA:E6V5E1"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E1"
FT                   /inference="protein motif:PFAM:PF10136"
FT                   /protein_id="ADU34747.1"
FT                   /translation="MAAASRDLQGLLAGLDPTADVAQRHIWLINLFDWLRGDRASPQAA
FT                   MGRVSLLLDAVEARPELRERLRAWWRVFTQSVDLTTLLADYGFAPRTAFVSELSERLRR
FT                   KILPGTPETTDASDLFRMVLPGVFDAGWIALLDDTQLARIGALLADATVDTDGSPRWRH
FT                   TVMDAVTYCGSQVVAAGFSPELRLRISAEHHENRPFHALMADLDELREQMFEQPEGEES
FT                   DEALQAAFVAFRDRLDACRASASSVYTHLEDNGISVGLVFRLRQLRERVLRIRELLDCL
FT                   MSPSPAPSVARLIGKLVLAGGERNSIRALVATNSSMLAAKVTERSAETGEHYITRDRAS
FT                   YLQMVKKAAGGGALTAMTVLLKFGIYALALSAFWAGLASGLMYAASFVAIQLLHLTLAT
FT                   KQPAMTAPALAARLRDIKADGAVDHFVDEVANLVRSQVAAVLGNVLVVVPAMIALALLV
FT                   QYALGRPLLDAAHAAATLHSLSLAGPTALFAAITGILLFSASIVAGWTENAFVLHRLDS
FT                   AMRYNPRIGAFLGAARARRWATFMRTHISGFASNISLGLMLGLLPAFAGFFGLGLDVRH
FT                   VTLSAGQIAAATASTGLSVLQQPALWWAVAAIPVIGALNVSVSFYFAFRLALRAHSVSL
FT                   GDRARIRSAIWARWRSRPVSFFLPA"
     MAAASRDLQG LLAGLDPTAD VAQRHIWLIN LFDWLRGDRA SPQAAMGRVS LLLDAVEARP        60
     ELRERLRAWW RVFTQSVDLT TLLADYGFAP RTAFVSELSE RLRRKILPGT PETTDASDLF       120
     RMVLPGVFDA GWIALLDDTQ LARIGALLAD ATVDTDGSPR WRHTVMDAVT YCGSQVVAAG       180
     FSPELRLRIS AEHHENRPFH ALMADLDELR EQMFEQPEGE ESDEALQAAF VAFRDRLDAC       240
     RASASSVYTH LEDNGISVGL VFRLRQLRER VLRIRELLDC LMSPSPAPSV ARLIGKLVLA       300
     GGERNSIRAL VATNSSMLAA KVTERSAETG EHYITRDRAS YLQMVKKAAG GGALTAMTVL       360
     LKFGIYALAL SAFWAGLASG LMYAASFVAI QLLHLTLATK QPAMTAPALA ARLRDIKADG       420
     AVDHFVDEVA NLVRSQVAAV LGNVLVVVPA MIALALLVQY ALGRPLLDAA HAAATLHSLS       480
     LAGPTALFAA ITGILLFSAS IVAGWTENAF VLHRLDSAMR YNPRIGAFLG AARARRWATF       540
     MRTHISGFAS NISLGLMLGL LPAFAGFFGL GLDVRHVTLS AGQIAAATAS TGLSVLQQPA       600
     LWWAVAAIPV IGALNVSVSF YFAFRLALRA HSVSLGDRAR IRSAIWARWR SRPVSFFLPA       660
//

If you have problems or comments...

PBIL Back to PBIL home page