(data stored in ACNUC1104 zone)

EMBL: CP002417.PE526

CP002417.PE526       Location/Qualifiers
FT   CDS             570000..570692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0528"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   vap:Vapar_0494 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34749"
FT                   /db_xref="GOA:E6V5E3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E3"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADU34749.1"
FT                   /translation="MSTPFRIAPSILSADFAHLGQELTDVIAAGADWIHFDVMDNHYVP
FT                   NLTFGPMICQALKPYAKTADGTPVPIDVHLMIQPVDALAASFAQAGADYISFHPDASPH
FT                   VHRSIQAIKAAGCKAGLVFNPGLGLEALDWAIDDIDLILIMSVNPGFGGQSFIDSALRK
FT                   IELARKRIEQSGRDIRLEVDGGIKADNIARVASAGADTFVAGSAIFNAKDYGAVIGEMR
FT                   KNLAGVSA"
     MSTPFRIAPS ILSADFAHLG QELTDVIAAG ADWIHFDVMD NHYVPNLTFG PMICQALKPY        60
     AKTADGTPVP IDVHLMIQPV DALAASFAQA GADYISFHPD ASPHVHRSIQ AIKAAGCKAG       120
     LVFNPGLGLE ALDWAIDDID LILIMSVNPG FGGQSFIDSA LRKIELARKR IEQSGRDIRL       180
     EVDGGIKADN IARVASAGAD TFVAGSAIFN AKDYGAVIGE MRKNLAGVSA                  230
//

If you have problems or comments...

PBIL Back to PBIL home page