(data stored in ACNUC1104 zone)

EMBL: CP002417.PE528

CP002417.PE528       Location/Qualifiers
FT   CDS             571073..572110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0530"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: vap:Vapar_0496
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34751"
FT                   /db_xref="GOA:E6V5E5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E5"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADU34751.1"
FT                   /translation="MRRWKGLRNNPRMSSDPFAGVATDSLRIHTFASLHPGPRLLVIGG
FT                   VHGNETCGTAGIERILAEFDAGTLQLQRGELTLVPVANPLARRRLQREGERNLNRLFRP
FT                   TDEPADYEACITNRLAPVIARHEVLLDLHSFQSEGEAFAMIGPRDNTGTLEPFARSYEE
FT                   GQLALHIGTPIVVEGWLDIYAAGLAQRAGGAPADEAALDFGRGTNEYIRSCGGYGVTLE
FT                   CGQHDDPQAPEVAWRAIRRTLALLGMAALPPGLSGAPAQPPKLLRLASVTDRLHEEDSF
FT                   VRDWATFDEVRRGEPIGMRHDGTMLNAPDDGFIVFPNALALPGTEWFYFAHPSERVLGP
FT                   VTGTA"
     MRRWKGLRNN PRMSSDPFAG VATDSLRIHT FASLHPGPRL LVIGGVHGNE TCGTAGIERI        60
     LAEFDAGTLQ LQRGELTLVP VANPLARRRL QREGERNLNR LFRPTDEPAD YEACITNRLA       120
     PVIARHEVLL DLHSFQSEGE AFAMIGPRDN TGTLEPFARS YEEGQLALHI GTPIVVEGWL       180
     DIYAAGLAQR AGGAPADEAA LDFGRGTNEY IRSCGGYGVT LECGQHDDPQ APEVAWRAIR       240
     RTLALLGMAA LPPGLSGAPA QPPKLLRLAS VTDRLHEEDS FVRDWATFDE VRRGEPIGMR       300
     HDGTMLNAPD DGFIVFPNAL ALPGTEWFYF AHPSERVLGP VTGTA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page