(data stored in ACNUC1104 zone)

EMBL: CP002417.PE530

CP002417.PE530       Location/Qualifiers
FT   CDS             573184..575793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0532"
FT                   /product="DNA ligase D"
FT                   /note="KEGG: pol:Bpro_3003 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase D; DNA polymerase LigD, ligase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   DNA polymerase LigD, polymerase domain protein; PFAM: ATP
FT                   dependent DNA ligase; ATP dependent DNA ligase domain
FT                   protein; DNA primase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34753"
FT                   /db_xref="GOA:E6V5E7"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5E7"
FT                   /inference="protein motif:TFAM:TIGR02776"
FT                   /protein_id="ADU34753.1"
FT                   /translation="MGTTRTASTARKALSRYHGKRDFSRTPEPKEGGRAGQGVLSFVIQ
FT                   KHHASRLHYDFRLELDGTLKSWAVPKGPCLDPTVKRMAVHVEDHPISYADFEGTIPPKQ
FT                   YGAGTVIVWDRGDWLPEGGSEADARKALAAGKLKFELRGEKLKGHWTLVRMRGKGDEKQ
FT                   EPWLLIKERDDAARDLADYDVLEEQPASVLTGRGLDEVDSPPKKAAPAKKAAAKKPEKK
FT                   AAKKEVKKEVKKKAALPATLQPQLAVLAASPPSSPDDWLYELKFDGYRLLARIDKGKVR
FT                   CFTRNGHDWTDKLPVIAKALAKLPTDSAWLDGEITVEGGNGAPDFQALQNAFDRGATSS
FT                   IVYWLFDAPFLDGQDLRDEPVEERRAHLARLLGKRPPATLRLSEAFDASPRDLLASSAR
FT                   IGFEGIVGKRKGSPYVSRRSADWIKLKNQQRQEFVIGGYTAPKGSRSGFGALLLGVHDD
FT                   KGRLRYCGNVGTGFNADRLADIKARLDRLATDDCPFKPMPDGANAKAQWVKPTLVAEVS
FT                   FGEWTREDRVRQAVFQGLRTDKPARGIVRERAAPSETSPETSTEASTDTPAKKQGARKS
FT                   MALKITHADRVIDAKSGITKGELAAYYDAVGTLMLPHLRGRPVSLVRAPDGVGGELFFQ
FT                   KHIQNREIPGVNLLDPALDPGHEPLLQIDSKTGLIGAAQMNVIELHTWNATSRAIDRPD
FT                   RMTFDLDPGEGVGWPQIQEATLLVRTLLDELGLPSFLKTSGGKGMHVVVPIRRQYGWDE
FT                   VKGFSQAVVVHLAKTIPDRFVAKSGPRNRVGKVFVDYLRNGFGATTVSAWSARSRPGLG
FT                   VSVPVAWEELPALTGAAQWTVANVAERLATGNKPWAAMERSRKGIAAAMKMLDYKPA"
     MGTTRTASTA RKALSRYHGK RDFSRTPEPK EGGRAGQGVL SFVIQKHHAS RLHYDFRLEL        60
     DGTLKSWAVP KGPCLDPTVK RMAVHVEDHP ISYADFEGTI PPKQYGAGTV IVWDRGDWLP       120
     EGGSEADARK ALAAGKLKFE LRGEKLKGHW TLVRMRGKGD EKQEPWLLIK ERDDAARDLA       180
     DYDVLEEQPA SVLTGRGLDE VDSPPKKAAP AKKAAAKKPE KKAAKKEVKK EVKKKAALPA       240
     TLQPQLAVLA ASPPSSPDDW LYELKFDGYR LLARIDKGKV RCFTRNGHDW TDKLPVIAKA       300
     LAKLPTDSAW LDGEITVEGG NGAPDFQALQ NAFDRGATSS IVYWLFDAPF LDGQDLRDEP       360
     VEERRAHLAR LLGKRPPATL RLSEAFDASP RDLLASSARI GFEGIVGKRK GSPYVSRRSA       420
     DWIKLKNQQR QEFVIGGYTA PKGSRSGFGA LLLGVHDDKG RLRYCGNVGT GFNADRLADI       480
     KARLDRLATD DCPFKPMPDG ANAKAQWVKP TLVAEVSFGE WTREDRVRQA VFQGLRTDKP       540
     ARGIVRERAA PSETSPETST EASTDTPAKK QGARKSMALK ITHADRVIDA KSGITKGELA       600
     AYYDAVGTLM LPHLRGRPVS LVRAPDGVGG ELFFQKHIQN REIPGVNLLD PALDPGHEPL       660
     LQIDSKTGLI GAAQMNVIEL HTWNATSRAI DRPDRMTFDL DPGEGVGWPQ IQEATLLVRT       720
     LLDELGLPSF LKTSGGKGMH VVVPIRRQYG WDEVKGFSQA VVVHLAKTIP DRFVAKSGPR       780
     NRVGKVFVDY LRNGFGATTV SAWSARSRPG LGVSVPVAWE ELPALTGAAQ WTVANVAERL       840
     ATGNKPWAAM ERSRKGIAAA MKMLDYKPA                                         869
//

If you have problems or comments...

PBIL Back to PBIL home page