(data stored in SCRATCH zone)

EMBL: CP002417.PE533

CP002417.PE533       Location/Qualifiers
FT   CDS             577267..579462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0535"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: vap:Vapar_0501 catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein; ThiJ/PfpI
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34756"
FT                   /db_xref="GOA:E6V5F0"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F0"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADU34756.1"
FT                   /translation="MTPQNKAAAGRRANATKTAKSGDGRNTKQLQLDGFTTEHPAHLTT
FT                   NQGLQIPDNHNSLKAGVRGPTLLEDFILREKITHFDHERIPERAVHARGSAAHGYFQVY
FT                   KSMSQFTSADFLQDPDVKTPVFVRFSTVAGERGSADTVRDVRGFAVKFYTREGNYDLVG
FT                   NNIPVFFIQDAMKFPDLIHAVKPEPHHAMPQAASAHDTFWDFASLMPESTHMLMWAMSD
FT                   RAIPRSYRMMEGFGVHTFRFVNSHGESHFVKFHWKPKLGIHGLVWDEAQKIAGKDADFH
FT                   RRDLWEAIENGDFPEWELGVQIIPADKEHSLGFDLLDPTKLIPEEMVPVQRIGKLVLDR
FT                   NPDNFFAETEQVAFHPGHVVPGIDFSNDPLLQGRLFSYTDTQISRLGGANFHELPINKG
FT                   VCPFHNFQRDGMHRQTIARGQVAYEPNTLGSGTEFRVDGGSNGFQSFPEAIDAPKVRRR
FT                   SASFDDHFTQARLFFNSQSVAEKEHIIAAFRFELSKLEVPAIRQRMVDNLAHVDEKLAR
FT                   RVAEPLGIGEPDAKAAAGRAGFRDHRIALPIDESPALSMADTGDGSIRTRKIAILVADG
FT                   IDSASLKPIREALEQAGAQCKIVGPRLGTVASASKRQIDVEMTFSNTPSVMFDAVLVPA
FT                   GADSAATMSATGDAVHFVLEAYKHCKAICTVGEGVKLLASLGVGADGDAPAGVVVAATP
FT                   VTNLGDTTAAQQIAQDFVAAIGKHRHWDRANIDAVPA"
     MTPQNKAAAG RRANATKTAK SGDGRNTKQL QLDGFTTEHP AHLTTNQGLQ IPDNHNSLKA        60
     GVRGPTLLED FILREKITHF DHERIPERAV HARGSAAHGY FQVYKSMSQF TSADFLQDPD       120
     VKTPVFVRFS TVAGERGSAD TVRDVRGFAV KFYTREGNYD LVGNNIPVFF IQDAMKFPDL       180
     IHAVKPEPHH AMPQAASAHD TFWDFASLMP ESTHMLMWAM SDRAIPRSYR MMEGFGVHTF       240
     RFVNSHGESH FVKFHWKPKL GIHGLVWDEA QKIAGKDADF HRRDLWEAIE NGDFPEWELG       300
     VQIIPADKEH SLGFDLLDPT KLIPEEMVPV QRIGKLVLDR NPDNFFAETE QVAFHPGHVV       360
     PGIDFSNDPL LQGRLFSYTD TQISRLGGAN FHELPINKGV CPFHNFQRDG MHRQTIARGQ       420
     VAYEPNTLGS GTEFRVDGGS NGFQSFPEAI DAPKVRRRSA SFDDHFTQAR LFFNSQSVAE       480
     KEHIIAAFRF ELSKLEVPAI RQRMVDNLAH VDEKLARRVA EPLGIGEPDA KAAAGRAGFR       540
     DHRIALPIDE SPALSMADTG DGSIRTRKIA ILVADGIDSA SLKPIREALE QAGAQCKIVG       600
     PRLGTVASAS KRQIDVEMTF SNTPSVMFDA VLVPAGADSA ATMSATGDAV HFVLEAYKHC       660
     KAICTVGEGV KLLASLGVGA DGDAPAGVVV AATPVTNLGD TTAAQQIAQD FVAAIGKHRH       720
     WDRANIDAVP A                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page