(data stored in SCRATCH zone)

EMBL: CP002417.PE534

CP002417.PE534       Location/Qualifiers
FT   CDS             complement(579483..581045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0536"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: bch:Bcen2424_6420 Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34757"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F1"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADU34757.1"
FT                   /translation="MNDLPRNMNLKTFNPHRADFACVHEAAKLPPIAVEVEMLFQQGMA
FT                   VTNNELWPNQRDYKKAAQLWEKAAAMGHWKAAMNLAGLHERGLGVQRDTERAVLIVEGL
FT                   MKQGVPGAFDKMGTYHQSGIGVKSDIDRAYGFWQLAADMGNPAAQTYIGDKLDAAYDDA
FT                   QMGIWGNRKVGLKMLECAFAQGDGEAAYRLGQTLDIDKNYTRALVVLHEGAKFGSADAA
FT                   NYLSSSFTQVDPLSGNQIDRARSERYSLLGDALELNPDLRFPNLDKVLPLPPASLPFWD
FT                   GKRETLIDAAKAVIVKQPTPATPGANRTGRTHIPQGYVLTGNIAPPPDENAYDNHGRPW
FT                   SLKARQHAHFTGYWLPQIDVIRGDWQANWNAAQVPWKFNRGEPLPNLAEQVPPGYGAVS
FT                   WHYKGLPVQQAASSHPYVAQGIARYVPGPEAPRSCSGTVPCPQTGIWSAGLKKEHAHHA
FT                   VFHEPWRQAYIEEGQPFPVPTTLHEAGGITVAARDIRWHWIGDANRADTSGHVHVTLTT
FT                   IDS"
     MNDLPRNMNL KTFNPHRADF ACVHEAAKLP PIAVEVEMLF QQGMAVTNNE LWPNQRDYKK        60
     AAQLWEKAAA MGHWKAAMNL AGLHERGLGV QRDTERAVLI VEGLMKQGVP GAFDKMGTYH       120
     QSGIGVKSDI DRAYGFWQLA ADMGNPAAQT YIGDKLDAAY DDAQMGIWGN RKVGLKMLEC       180
     AFAQGDGEAA YRLGQTLDID KNYTRALVVL HEGAKFGSAD AANYLSSSFT QVDPLSGNQI       240
     DRARSERYSL LGDALELNPD LRFPNLDKVL PLPPASLPFW DGKRETLIDA AKAVIVKQPT       300
     PATPGANRTG RTHIPQGYVL TGNIAPPPDE NAYDNHGRPW SLKARQHAHF TGYWLPQIDV       360
     IRGDWQANWN AAQVPWKFNR GEPLPNLAEQ VPPGYGAVSW HYKGLPVQQA ASSHPYVAQG       420
     IARYVPGPEA PRSCSGTVPC PQTGIWSAGL KKEHAHHAVF HEPWRQAYIE EGQPFPVPTT       480
     LHEAGGITVA ARDIRWHWIG DANRADTSGH VHVTLTTIDS                             520
//

If you have problems or comments...

PBIL Back to PBIL home page