(data stored in ACNUC1104 zone)

EMBL: CP002417.PE537

CP002417.PE537       Location/Qualifiers
FT   CDS             586337..588475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0539"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: vap:Vapar_0502 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34760"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0502"
FT                   /protein_id="ADU34760.1"
FT                   /translation="MAWFSRWGWERPARCRAGIAGALGLAGILLLGFGPPVSAQPNAEA
FT                   AASKAEQARLADTDTLLALTSEGAVLYGQDAVKLSGYQYCSQAVALAEAGEFRQSIRAA
FT                   SKALHLANATRDPNLMAMANRDLAIVYSYSGQLEKAEEFAREALKHPARDPKLVVGPVQ
FT                   KVIGDVRTRRGDFSGAVLSYDEALANSSPRYAPLVQASLVNALIESGDAVRAREVLGTM
FT                   PPPKDAPLTAQLDRTRARLLLAENKPAEARDMYRALTARQVGADTEYYRLWAWDGVARS
FT                   EIALGQKQAAAEAVGQALGGVDKVRAKFRSEEFKMGLFSDLQSVFERGVSVYSDAGDAR
FT                   AAFEVSEHSRSRALLDAVRGRAKVSEQASNTVDLATLQRTLAADERVVQFHSLPDRLVV
FT                   WVVSPSAIQEKTVAVKREELNELVETFRNSIVRGRRTAITNADKLGAALLGPLGLAPGQ
FT                   RLVIVPHGPLHYLPFQALRLDGRYIIETHPVSVAPSMSIAVQLAQRTPRVNASLTAFGN
FT                   PRIEDKYDLPGAETEVKQLAQLFPRNTVFMGAAATKTQFRDVAARSPLMHVAAHAEADA
FT                   VDPLYSRILLANEGGKQNFLEAHEILGMPMDGTALVTLSACESGLGRIAQGDEVLGFTR
FT                   SFLSAGSSSLIASLWPVSDDATAVLMGTLYGELSKGRDLQKAMQAGQLAVLKDPKMSHP
FT                   FFWAPFNLIGNWRLTVGS"
     MAWFSRWGWE RPARCRAGIA GALGLAGILL LGFGPPVSAQ PNAEAAASKA EQARLADTDT        60
     LLALTSEGAV LYGQDAVKLS GYQYCSQAVA LAEAGEFRQS IRAASKALHL ANATRDPNLM       120
     AMANRDLAIV YSYSGQLEKA EEFAREALKH PARDPKLVVG PVQKVIGDVR TRRGDFSGAV       180
     LSYDEALANS SPRYAPLVQA SLVNALIESG DAVRAREVLG TMPPPKDAPL TAQLDRTRAR       240
     LLLAENKPAE ARDMYRALTA RQVGADTEYY RLWAWDGVAR SEIALGQKQA AAEAVGQALG       300
     GVDKVRAKFR SEEFKMGLFS DLQSVFERGV SVYSDAGDAR AAFEVSEHSR SRALLDAVRG       360
     RAKVSEQASN TVDLATLQRT LAADERVVQF HSLPDRLVVW VVSPSAIQEK TVAVKREELN       420
     ELVETFRNSI VRGRRTAITN ADKLGAALLG PLGLAPGQRL VIVPHGPLHY LPFQALRLDG       480
     RYIIETHPVS VAPSMSIAVQ LAQRTPRVNA SLTAFGNPRI EDKYDLPGAE TEVKQLAQLF       540
     PRNTVFMGAA ATKTQFRDVA ARSPLMHVAA HAEADAVDPL YSRILLANEG GKQNFLEAHE       600
     ILGMPMDGTA LVTLSACESG LGRIAQGDEV LGFTRSFLSA GSSSLIASLW PVSDDATAVL       660
     MGTLYGELSK GRDLQKAMQA GQLAVLKDPK MSHPFFWAPF NLIGNWRLTV GS               712
//

If you have problems or comments...

PBIL Back to PBIL home page