(data stored in ACNUC1104 zone)

EMBL: CP002417.PE539

CP002417.PE539       Location/Qualifiers
FT   CDS             590272..595749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0541"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0504 filamentous hemagglutinin
FT                   family outer membrane protein; TIGRFAM: filamentous
FT                   haemagglutinin family outer membrane protein; PFAM:
FT                   filamentous haemagglutinin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34762"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F6"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ADU34762.1"
FT                   /translation="MKQRSNPSRQRPRHHRGLQLRPLAISLLCAGLSPAIAQVLPTGFL
FT                   PIAGGVTMSQTGAVMSINQPLARGIASWQTFSIGAGGTVNIVQQSASSVLLNRVTGNEL
FT                   STIAGTLNANGRVILVNPNGVMFSQGATVNVGGLIASTLALTTSDKSFMDGATKLTFER
FT                   ADLNSAEVRNLGSITATGGGPVVLMGAAVGNGSTGTITADNGTVALASGRRITLDLVGD
FT                   GLTNLVIAPDAMATHAAVSNGGTIQADGGRVALVGSSVTAGELVVNQTGTVRARSIGTR
FT                   NGEIILGGGRDNQVAMTGGTLDATGDTANERGGSIRIAAGQVQLQANDKGQQAVVDASG
FT                   LAGGGTVAVRGYDVALSSGSVLRANATGQGAGGTIDVGTATGQVLVDGLTAPERESHAQ
FT                   VFGELSARGAGTGAGGAITTSGDFLRINPAKVDAGGGTQGGANGKWTVTAASDLNVVSA
FT                   ADIPAYDSIYPPLSITNVSAEGIGGTLGRGTDVTLSSSSIGDNAGVRFAADAKVIKSEG
FT                   GTATLRVDSAGSIVMATGSAIDARTGALHVDFNADSTGRVAENAAVINSGSGPVTELDY
FT                   AGSIRLSGATINANGGSVRFFGQSDAANGRAIGGSASHTDEPADSWRDGVYLNASSVTT
FT                   SGSGQVSMRGQGRSWVSDPSGTGGFYVGSGGVVVTNDSAVQAGTGGVSLDGVAGFGASG
FT                   VAAQDGAKVVATGDIAITGRGAAWNDTMPAAGAGSSTAVLIDAASVASDRNVRIDGTGA
FT                   DLDGFRTSKAFAAQNDFAGSSQGVSIYGSVTAGEGQRIDVNGRAGNQSFTSTLDDSGNI
FT                   VVTPFGQVYGVVVRANEALPNPLRTSGGTIAIDGQGTDVSLRMETFGSGSFALAAAPEP
FT                   GALAAPPQPALLSVMSETGKGGNISVRGRNIVIDGAEQFGDVPLVGRLDASGATGGGSI
FT                   DIAATGVIAVGANASLEANATGSGNGGSVKVVAGDSLRAYGNLSARGGAEGGNGGFIET
FT                   SAAQFDLAGIRADASAPVGNAGSWLIDPFDVDIVSGVATGSLTGNPFDPIAASTIQDGD
FT                   INAALNAGTSVTIGTGSTGSPLLGDIHMSNAKGAVNINYSTNKGPVTFQLDANRSVRGD
FT                   AGTVIQSTGGGALNVVFNADVNNGGTATGGGQISYSGDIYTNGGNVVMNGSWANPSNQS
FT                   VSVNLDGNEIDTRVGRSDAGAGGSVTIVGKSIGLGGIGDAAVAVDGVHISTSTGNVNIT
FT                   GTAEGASGVRLGSRFVATGIPNRQTEITSTTGNITVLGVGNSVTSAGTTPGHGVIIDQS
FT                   ALRSVDGDITVRGLRQAGGPTVGDGVRLTTGAQVVTSGTGDIELSGQSVGNGAGVRVGP
FT                   QAALGGAVPPVLADVIVSAGGNTVLRAGNDGSTDALVIDGKVSAANVINLRPGGVDAAG
FT                   NGVDQTGTPITLGGTAATGFAVSAAEFGRLTAPTIVAGSNAHAANIDVVGPLTLPSALT
FT                   LQNGGGGNIQLGGAIAATRLGLLSAGNITQAAGAPITAGTLMARSTGGSVLLDMAPNNV
FT                   SAATVGGGAAGAFRYVDVDTVQLGSVSVTGFDAASNAPQVQSATSMAADTVFVRTLSGD
FT                   LLLGTNVSSTRGTDLVAASRFQNLGAYTITGAPWRVWADTWGGETRGGLFGSGPLPNLY
FT                   HCAYLGLCTVTVSPGDNHFIYAQQPVATVVIGNATRPAGQANPPFTYTVAGLILGDTAS
FT                   SFSGAPGTSATPDSPPGLYAINGSFASAAGYAVNVRPGDLTVTEAPPPSVVLRLPDFPK
FT                   PDVLREVPSTWLYDRNVGPPPICFATGALEGDRASQGGDVLAREWSRVRSRPNLSSCVD
FT                   TEKRNGCADF"
     MKQRSNPSRQ RPRHHRGLQL RPLAISLLCA GLSPAIAQVL PTGFLPIAGG VTMSQTGAVM        60
     SINQPLARGI ASWQTFSIGA GGTVNIVQQS ASSVLLNRVT GNELSTIAGT LNANGRVILV       120
     NPNGVMFSQG ATVNVGGLIA STLALTTSDK SFMDGATKLT FERADLNSAE VRNLGSITAT       180
     GGGPVVLMGA AVGNGSTGTI TADNGTVALA SGRRITLDLV GDGLTNLVIA PDAMATHAAV       240
     SNGGTIQADG GRVALVGSSV TAGELVVNQT GTVRARSIGT RNGEIILGGG RDNQVAMTGG       300
     TLDATGDTAN ERGGSIRIAA GQVQLQANDK GQQAVVDASG LAGGGTVAVR GYDVALSSGS       360
     VLRANATGQG AGGTIDVGTA TGQVLVDGLT APERESHAQV FGELSARGAG TGAGGAITTS       420
     GDFLRINPAK VDAGGGTQGG ANGKWTVTAA SDLNVVSAAD IPAYDSIYPP LSITNVSAEG       480
     IGGTLGRGTD VTLSSSSIGD NAGVRFAADA KVIKSEGGTA TLRVDSAGSI VMATGSAIDA       540
     RTGALHVDFN ADSTGRVAEN AAVINSGSGP VTELDYAGSI RLSGATINAN GGSVRFFGQS       600
     DAANGRAIGG SASHTDEPAD SWRDGVYLNA SSVTTSGSGQ VSMRGQGRSW VSDPSGTGGF       660
     YVGSGGVVVT NDSAVQAGTG GVSLDGVAGF GASGVAAQDG AKVVATGDIA ITGRGAAWND       720
     TMPAAGAGSS TAVLIDAASV ASDRNVRIDG TGADLDGFRT SKAFAAQNDF AGSSQGVSIY       780
     GSVTAGEGQR IDVNGRAGNQ SFTSTLDDSG NIVVTPFGQV YGVVVRANEA LPNPLRTSGG       840
     TIAIDGQGTD VSLRMETFGS GSFALAAAPE PGALAAPPQP ALLSVMSETG KGGNISVRGR       900
     NIVIDGAEQF GDVPLVGRLD ASGATGGGSI DIAATGVIAV GANASLEANA TGSGNGGSVK       960
     VVAGDSLRAY GNLSARGGAE GGNGGFIETS AAQFDLAGIR ADASAPVGNA GSWLIDPFDV      1020
     DIVSGVATGS LTGNPFDPIA ASTIQDGDIN AALNAGTSVT IGTGSTGSPL LGDIHMSNAK      1080
     GAVNINYSTN KGPVTFQLDA NRSVRGDAGT VIQSTGGGAL NVVFNADVNN GGTATGGGQI      1140
     SYSGDIYTNG GNVVMNGSWA NPSNQSVSVN LDGNEIDTRV GRSDAGAGGS VTIVGKSIGL      1200
     GGIGDAAVAV DGVHISTSTG NVNITGTAEG ASGVRLGSRF VATGIPNRQT EITSTTGNIT      1260
     VLGVGNSVTS AGTTPGHGVI IDQSALRSVD GDITVRGLRQ AGGPTVGDGV RLTTGAQVVT      1320
     SGTGDIELSG QSVGNGAGVR VGPQAALGGA VPPVLADVIV SAGGNTVLRA GNDGSTDALV      1380
     IDGKVSAANV INLRPGGVDA AGNGVDQTGT PITLGGTAAT GFAVSAAEFG RLTAPTIVAG      1440
     SNAHAANIDV VGPLTLPSAL TLQNGGGGNI QLGGAIAATR LGLLSAGNIT QAAGAPITAG      1500
     TLMARSTGGS VLLDMAPNNV SAATVGGGAA GAFRYVDVDT VQLGSVSVTG FDAASNAPQV      1560
     QSATSMAADT VFVRTLSGDL LLGTNVSSTR GTDLVAASRF QNLGAYTITG APWRVWADTW      1620
     GGETRGGLFG SGPLPNLYHC AYLGLCTVTV SPGDNHFIYA QQPVATVVIG NATRPAGQAN      1680
     PPFTYTVAGL ILGDTASSFS GAPGTSATPD SPPGLYAING SFASAAGYAV NVRPGDLTVT      1740
     EAPPPSVVLR LPDFPKPDVL REVPSTWLYD RNVGPPPICF ATGALEGDRA SQGGDVLARE      1800
     WSRVRSRPNL SSCVDTEKRN GCADF                                            1825
//

If you have problems or comments...

PBIL Back to PBIL home page