(data stored in ACNUC1104 zone)

EMBL: CP002417.PE54

CP002417.PE54        Location/Qualifiers
FT   CDS             56723..57268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0054"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   vap:Vapar_0049 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34277"
FT                   /db_xref="GOA:E6UXT3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT3"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADU34277.1"
FT                   /translation="MTVSRILLLPGWQNSGPGHWQTIWESIHGDRRVEQHDWMRPLRGD
FT                   WSARLEEEVLAAPGPVAFAAHSLGCILVAAWAAHSRNTHKVAGALLVAPGDVEREDLRQ
FT                   LIPGWAPIVRQPLPFSSVLIAANDDPYCEASRSRQLAKDWGARFIDAGKGGHLNAESGL
FT                   GDWPEGRQLLNDISKDKN"
     MTVSRILLLP GWQNSGPGHW QTIWESIHGD RRVEQHDWMR PLRGDWSARL EEEVLAAPGP        60
     VAFAAHSLGC ILVAAWAAHS RNTHKVAGAL LVAPGDVERE DLRQLIPGWA PIVRQPLPFS       120
     SVLIAANDDP YCEASRSRQL AKDWGARFID AGKGGHLNAE SGLGDWPEGR QLLNDISKDK       180
     N                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page