(data stored in ACNUC1104 zone)

EMBL: CP002417.PE541

CP002417.PE541       Location/Qualifiers
FT   CDS             complement(597447..598232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34764"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0507"
FT                   /protein_id="ADU34764.1"
FT                   /translation="MPDLSALKDIRPFVATPSYGGTMTSLYVRSLLGLVNLAWEHRFPM
FT                   QTRFLDGDSLITRARNRLVAEFMADTRWTHLFWIDADIGFEPEAALRLLCAGRDVVAGI
FT                   YPHKTDGWPAGGLREPLPAGATREDFEALHASFPANAFDTRLSVDAEGFTEVLDAPTGF
FT                   MLIARSVFERLAAAYPQLRYTPERAADPATRDLPHYRFFDVLAEPDNGAYLAEDFAFCR
FT                   RWQSIGGQVFIDARSNLSHQGTRTYTGHFGRALAVREGR"
     MPDLSALKDI RPFVATPSYG GTMTSLYVRS LLGLVNLAWE HRFPMQTRFL DGDSLITRAR        60
     NRLVAEFMAD TRWTHLFWID ADIGFEPEAA LRLLCAGRDV VAGIYPHKTD GWPAGGLREP       120
     LPAGATREDF EALHASFPAN AFDTRLSVDA EGFTEVLDAP TGFMLIARSV FERLAAAYPQ       180
     LRYTPERAAD PATRDLPHYR FFDVLAEPDN GAYLAEDFAF CRRWQSIGGQ VFIDARSNLS       240
     HQGTRTYTGH FGRALAVREG R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page