(data stored in ACNUC1104 zone)

EMBL: CP002417.PE542

CP002417.PE542       Location/Qualifiers
FT   CDS             complement(598343..598975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0544"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   vap:Vapar_0488 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34765"
FT                   /db_xref="GOA:E6V5F9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5F9"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADU34765.1"
FT                   /translation="MSNTAAPRRVLVVIDVQNEYFEGGGLPIEYPPILDTLPNVTKAMD
FT                   AAHAAGVPVVVVRHHAPKGAPVFQADTHNGQLHPEVANRPRDHLITKTFPSVFTGTDFA
FT                   DWLALHEIDTLSVAGYMTQNCDASTVFEAMHRGLNVEFLADASGALPYANDAGKVTAEE
FT                   IHRVFSVVFHSNFAAVTSTAAWITAMQEGQAIAKDNVVMSNRRARGV"
     MSNTAAPRRV LVVIDVQNEY FEGGGLPIEY PPILDTLPNV TKAMDAAHAA GVPVVVVRHH        60
     APKGAPVFQA DTHNGQLHPE VANRPRDHLI TKTFPSVFTG TDFADWLALH EIDTLSVAGY       120
     MTQNCDASTV FEAMHRGLNV EFLADASGAL PYANDAGKVT AEEIHRVFSV VFHSNFAAVT       180
     STAAWITAMQ EGQAIAKDNV VMSNRRARGV                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page