(data stored in ACNUC1104 zone)

EMBL: CP002417.PE545

CP002417.PE545       Location/Qualifiers
FT   CDS             complement(602187..603266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0547"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: vap:Vapar_0509 ABC-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34768"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G2"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0509"
FT                   /protein_id="ADU34768.1"
FT                   /translation="MSVVAKHLFHPFPGRLRGAVRAALAFGLTAGVAVGLLGLSMASRA
FT                   AAAPSLTVLMSDDNPAHSEFVQQLRAGQEPGGRFELVRLSPTGEMPQGVETASAETEPR
FT                   ANAGVRTRSMRPSAADANLTMAVGAAAARAAVERPGQEPLVLAMLSRLDYEALKAASPA
FT                   LKRGDRRVGVLLRDPAMADQLALIHAVLPQKHRIGVVATPESEPLVRELQRAAQGANPA
FT                   WEVRVEYAPDARSLAAALRTVVPMSDALMVLPDLIGDNQAATLSVLRAGASAGLAVFGA
FT                   SEGLVRSGGLAAAVSTPSQLAQQARLLGQKVAVAGSSNSPLVEAATPATVRVNATVARG
FT                   LGLRLPEERELTDRLAAPR"
     MSVVAKHLFH PFPGRLRGAV RAALAFGLTA GVAVGLLGLS MASRAAAAPS LTVLMSDDNP        60
     AHSEFVQQLR AGQEPGGRFE LVRLSPTGEM PQGVETASAE TEPRANAGVR TRSMRPSAAD       120
     ANLTMAVGAA AARAAVERPG QEPLVLAMLS RLDYEALKAA SPALKRGDRR VGVLLRDPAM       180
     ADQLALIHAV LPQKHRIGVV ATPESEPLVR ELQRAAQGAN PAWEVRVEYA PDARSLAAAL       240
     RTVVPMSDAL MVLPDLIGDN QAATLSVLRA GASAGLAVFG ASEGLVRSGG LAAAVSTPSQ       300
     LAQQARLLGQ KVAVAGSSNS PLVEAATPAT VRVNATVARG LGLRLPEERE LTDRLAAPR        359
//

If you have problems or comments...

PBIL Back to PBIL home page