(data stored in ACNUC1104 zone)

EMBL: CP002417.PE547

CP002417.PE547       Location/Qualifiers
FT   CDS             605457..606515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0549"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: vap:Vapar_0512
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34770"
FT                   /db_xref="GOA:E6V5G4"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G4"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADU34770.1"
FT                   /translation="MLAFLRHFAAVPAVFSAAFRAAALAFFVGLPVVAAAQTAQAAPPD
FT                   KTAVRFGILPLGGAFESRSDWDPLLAELSRAIHRPVSVLSVNSYEALEQAIQRDEVDMA
FT                   FLSGKMALDAVTQRRMKVVAQVVRHDGLPGYRALLLARKTPPLNTLKDLMDQPERWRLA
FT                   RGEKQSVSGFIVPQLQLFLPNHIVMETRFLSEVVGTHQTNALAVANSEADVATNNSADF
FT                   ERFKLRFPAEAQRLQVLWESELIPHAQIVVRREYPAELRSRVQAFLTAYGRGKGPRGDA
FT                   ERLVLKSLHDLAGFVVADNSSLQPAAKLAYQLAKQNAVTAQFVNDAAKQARLQRIENGY
FT                   AEQVSVLRDIAP"
     MLAFLRHFAA VPAVFSAAFR AAALAFFVGL PVVAAAQTAQ AAPPDKTAVR FGILPLGGAF        60
     ESRSDWDPLL AELSRAIHRP VSVLSVNSYE ALEQAIQRDE VDMAFLSGKM ALDAVTQRRM       120
     KVVAQVVRHD GLPGYRALLL ARKTPPLNTL KDLMDQPERW RLARGEKQSV SGFIVPQLQL       180
     FLPNHIVMET RFLSEVVGTH QTNALAVANS EADVATNNSA DFERFKLRFP AEAQRLQVLW       240
     ESELIPHAQI VVRREYPAEL RSRVQAFLTA YGRGKGPRGD AERLVLKSLH DLAGFVVADN       300
     SSLQPAAKLA YQLAKQNAVT AQFVNDAAKQ ARLQRIENGY AEQVSVLRDI AP               352
//

If you have problems or comments...

PBIL Back to PBIL home page