(data stored in ACNUC1104 zone)

EMBL: CP002417.PE548

CP002417.PE548       Location/Qualifiers
FT   CDS             606583..607608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0550"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: vap:Vapar_0513
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34771"
FT                   /db_xref="GOA:E6V5G5"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G5"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADU34771.1"
FT                   /translation="MPPALKHLLAAAFIAASGLLPPSLALAQAVNEKPVQTIRFGVLPL
FT                   GGTVESRALWTPFMADMSRSLGIPVNAYSVPSYEELDRAIGKDEIDMAFLSAKMALDAV
FT                   MQRRMKVVAQIARRPGMPEHRAVLLARKAGPLNTLEGMLAQPERWRLARGDSRSVTGFV
FT                   VPQSQLFLPNNIEMETRFLSEFVGTHQATALAVANGDADVATNNTTDLERFRQQFPIEA
FT                   ERLQVIWESTPPPGAPMVVRRNYPPEFQAKLQNFLITYGQGKGPHADGEREVLKNLRAA
FT                   YGYVAADDSALLPEARLEYELGKQRAMAAAWVNEAARAQRLQRIEKAYAEQVQTLRAGG
FT                   R"
     MPPALKHLLA AAFIAASGLL PPSLALAQAV NEKPVQTIRF GVLPLGGTVE SRALWTPFMA        60
     DMSRSLGIPV NAYSVPSYEE LDRAIGKDEI DMAFLSAKMA LDAVMQRRMK VVAQIARRPG       120
     MPEHRAVLLA RKAGPLNTLE GMLAQPERWR LARGDSRSVT GFVVPQSQLF LPNNIEMETR       180
     FLSEFVGTHQ ATALAVANGD ADVATNNTTD LERFRQQFPI EAERLQVIWE STPPPGAPMV       240
     VRRNYPPEFQ AKLQNFLITY GQGKGPHADG EREVLKNLRA AYGYVAADDS ALLPEARLEY       300
     ELGKQRAMAA AWVNEAARAQ RLQRIEKAYA EQVQTLRAGG R                           341
//

If you have problems or comments...

PBIL Back to PBIL home page