(data stored in SCRATCH zone)

EMBL: CP002417.PE549

CP002417.PE549       Location/Qualifiers
FT   CDS             607752..609083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0551"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="KEGG: vap:Vapar_0514 type VI secretion protein,
FT                   VC_A0114 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0114 family; PFAM: protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34772"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G6"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ADU34772.1"
FT                   /translation="MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGF
FT                   AELEIDQAALTLGKLALVRAVGIFGDGTVFDMPAVDPLPEPIDIPSSMRDEAVVLALPL
FT                   RRAGAREADAEEYEELVRHRVLESDVPDSNTAGERTAMLQLGQLHTRLMRASEATDAWT
FT                   TMGVARVVERRTDNQVQLDRGMLPPLLDVAGHAVIRAWLDELLGLLRQRGEALAGRMTQ
FT                   GGTGGVAEIADFMLLQAVNRNEAIFAHLAKSAMLHPQHFFEHALGLAGDLSSFRDTRRV
FT                   ARFGPYIHDDLALSFRPVMDDLRRSLSMVFEQSAIRIELHDRKHGVRVAMVTDVELQRK
FT                   ATFVLAVNANMPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHT
FT                   GANYFELETRNSDLWRQLEQSGGIAMHIAGDFPGLDLAFWAIRS"
     MSWRTKVVWS EGMLLQPQHL QQSERHADHA RHVLLRSTTP YAWGFAELEI DQAALTLGKL        60
     ALVRAVGIFG DGTVFDMPAV DPLPEPIDIP SSMRDEAVVL ALPLRRAGAR EADAEEYEEL       120
     VRHRVLESDV PDSNTAGERT AMLQLGQLHT RLMRASEATD AWTTMGVARV VERRTDNQVQ       180
     LDRGMLPPLL DVAGHAVIRA WLDELLGLLR QRGEALAGRM TQGGTGGVAE IADFMLLQAV       240
     NRNEAIFAHL AKSAMLHPQH FFEHALGLAG DLSSFRDTRR VARFGPYIHD DLALSFRPVM       300
     DDLRRSLSMV FEQSAIRIEL HDRKHGVRVA MVTDVELQRK ATFVLAVNAN MPSEALRARF       360
     PTQVKIGPVE RIRDLVNLAL PGVTLTPMPV APRQIPFHTG ANYFELETRN SDLWRQLEQS       420
     GGIAMHIAGD FPGLDLAFWA IRS                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page