(data stored in ACNUC1104 zone)

EMBL: CP002417.PE55

CP002417.PE55        Location/Qualifiers
FT   CDS             57268..58209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0055"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: vap:Vapar_0050 ParB-like
FT                   partition protein; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34278"
FT                   /db_xref="GOA:E6UXT4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT4"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADU34278.1"
FT                   /translation="MATKKPKGLGRGLEALLGPTAAPAADHGNSGTEEGAAPPNPTTLM
FT                   LDQMVAGVYQPRTRMDEGALYELAESIKVQGIMQPILVRRLDAESAAAKNAEYEIIAGE
FT                   RRFRAAKLAGLESVPVLVRDVPNEAAAAMSLIENIQREDLNPLEEAQGLQRLVAEFGLT
FT                   HEMAAQAVGRSRSAASNLLRLLNLAEPAQQMLMAGDIDMGHARALLSLDRGTQITAANQ
FT                   IAAKKMSVRETEALVKKLAAEFTLTPSRRGNSGEKSRDLQRVEEELADLLTAEVEVRIK
FT                   KRTKRGESGELAIHFGSIEALNGLIERIRRTA"
     MATKKPKGLG RGLEALLGPT AAPAADHGNS GTEEGAAPPN PTTLMLDQMV AGVYQPRTRM        60
     DEGALYELAE SIKVQGIMQP ILVRRLDAES AAAKNAEYEI IAGERRFRAA KLAGLESVPV       120
     LVRDVPNEAA AAMSLIENIQ REDLNPLEEA QGLQRLVAEF GLTHEMAAQA VGRSRSAASN       180
     LLRLLNLAEP AQQMLMAGDI DMGHARALLS LDRGTQITAA NQIAAKKMSV RETEALVKKL       240
     AAEFTLTPSR RGNSGEKSRD LQRVEEELAD LLTAEVEVRI KKRTKRGESG ELAIHFGSIE       300
     ALNGLIERIR RTA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page