(data stored in ACNUC1104 zone)

EMBL: CP002417.PE550

CP002417.PE550       Location/Qualifiers
FT   CDS             609312..610676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0552"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="KEGG: vap:Vapar_0515 type IV / VI secretion system
FT                   protein, DotU family; TIGRFAM: type IV / VI secretion
FT                   system protein, DotU family; type VI secretion system
FT                   OmpA/MotB family protein; PFAM: Type IV / VI secretion
FT                   system, DotU; OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34773"
FT                   /db_xref="GOA:E6V5G7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G7"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ADU34773.1"
FT                   /translation="MSTPPDPFAAFESERTVIKPKPRTPAGTPPAATPAPFFGGADPTP
FT                   AVEVGEIGLLNPLVSAAGKLLVLIGKLRNLAQPPNVPALRASTADAVNQFDASARRSGV
FT                   SNESVLAARYVLCTALDEAVANTPWGVQAGWNKQSLLVQFHNETWGGEKVFQLLAKLAQ
FT                   DVPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAKDRPAVEPELSPH
FT                   WRGQGAGTVRLRESLPLWVFAAGFAFLLALAWVGMQIMLNQRSDTTYAAVSGLRVPNIQ
FT                   IAPPAPPAKTPRLARFLEPEVKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPV
FT                   LRRIGQALAEVKGDVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVDPARMR
FT                   SDGKADAEPVAANDTPANRARNRRVDIVLLTEPERIASAAPVAPAPAAPVPGATK"
     MSTPPDPFAA FESERTVIKP KPRTPAGTPP AATPAPFFGG ADPTPAVEVG EIGLLNPLVS        60
     AAGKLLVLIG KLRNLAQPPN VPALRASTAD AVNQFDASAR RSGVSNESVL AARYVLCTAL       120
     DEAVANTPWG VQAGWNKQSL LVQFHNETWG GEKVFQLLAK LAQDVPTHRQ LLELIYSVLA       180
     LGFEGRYRVV DNGRAQLDSV RQRLADLIAK DRPAVEPELS PHWRGQGAGT VRLRESLPLW       240
     VFAAGFAFLL ALAWVGMQIM LNQRSDTTYA AVSGLRVPNI QIAPPAPPAK TPRLARFLEP       300
     EVKQGLVTVT DEADRSVVRL RGDSFFGSGS AEPMAASLPV LRRIGQALAE VKGDVLITGH       360
     SDNQPIRSLR YPSNWHLSAA RADAVKGALT TLVDPARMRS DGKADAEPVA ANDTPANRAR       420
     NRRVDIVLLT EPERIASAAP VAPAPAAPVP GATK                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page