(data stored in ACNUC1104 zone)

EMBL: CP002417.PE551

CP002417.PE551       Location/Qualifiers
FT   CDS             610673..614272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0553"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="KEGG: vap:Vapar_0516 type VI secretion protein IcmF;
FT                   TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF domain
FT                   protein; protein of unknown function DUF1215"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34774"
FT                   /db_xref="GOA:E6V5G8"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5G8"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ADU34774.1"
FT                   /translation="MIKKIFGFLFSPLLLTLLALIVVGLLIWWIGPLVKIGSLAPLESE
FT                   LARWLLIGAIVLIVVLRMAWRRWRARRASQHLTDGLMKAPTVKTDAPANGEQKILDTRF
FT                   SEAVATLKQMRLHAAGKKPGWRDWMSISGGSYLYDLPWYVFIGAPGAGKTTALVNSGLS
FT                   FPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQTEDKNAWEGFLGLL
FT                   KKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDSKLTTRLPVYVLVTK
FT                   SDLLYGFTDYFDDLGKEQRAQVFGFTLPADENVQTEEKGLSTAFHREFALLHNRVNDGL
FT                   IPRMQRETDGGRRAAIFGFPAQFGSIGSLLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQ
FT                   EGSPIDRVMGSLSRSFGIERAMLAPQKSSGRSYFLTSLLRDVVFPEQRLAGADVKLERR
FT                   RHLLRMTGVAAMTLVTVGLIAGWGYSTWQNTNYLKSVEARAVPAQKSLANLPVQLQNLV
FT                   EVAPVMQGIRDIWKTPENRQGDEPLSMTLGLYQGNKLDAAARLAHQRALNDVFLPQIAK
FT                   RIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDPEALKAWITLDWARSLDRGIPEEQR
FT                   MALEEQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPGF
FT                   SVATAAGPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAAEDPWVLG
FT                   QDKGAADRLRDVAALGALTDRVRRLYLAEYVKQWEALLGDVRLIRATGLDKNIEAARIL
FT                   SGVSSPLANFLRAVVKETTLIPADQPKDVVSKATATVASTRKGLEDLFGGDPNKPVATG
FT                   KRIESIVDDRFEPLRRLVTAAAPGQPAPIDDALKLFNEVYVYLNAVDTAVKGRTSPPPG
FT                   DVAGKLKADAGRLPEPVRSMVENLSQSGAAQAQVAERGNLSQDLRPVTEFCARAIAGRY
FT                   PFSPTSKRDVLPEDFGQMFGAGGLMDDFFQKRLAALVDTSTRPWRYKPVAERGAITTQA
FT                   LAQFERAARIKDIFFRAGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPM
FT                   AVQWPGPKGSNQVRIQVSPPSTTGSSGSAVDGPWALFRALDDGQLEAGDAPEKFFITFQ
FT                   IGARKTRFEVTTNSVQHPIRLRELREFSCPEGL"
     MIKKIFGFLF SPLLLTLLAL IVVGLLIWWI GPLVKIGSLA PLESELARWL LIGAIVLIVV        60
     LRMAWRRWRA RRASQHLTDG LMKAPTVKTD APANGEQKIL DTRFSEAVAT LKQMRLHAAG       120
     KKPGWRDWMS ISGGSYLYDL PWYVFIGAPG AGKTTALVNS GLSFPLAEKF GPGAIRGVGG       180
     TRNCDWWFTD EAVLIDTAGR YTTQDSHQTE DKNAWEGFLG LLKKARPRRP LNGVFLTVSV       240
     ADLLSQGPEQ RTQLAASIRA RLLELDSKLT TRLPVYVLVT KSDLLYGFTD YFDDLGKEQR       300
     AQVFGFTLPA DENVQTEEKG LSTAFHREFA LLHNRVNDGL IPRMQRETDG GRRAAIFGFP       360
     AQFGSIGSLL SDLLDQVFTG SRFAQPPWVR GVYFTSGTQE GSPIDRVMGS LSRSFGIERA       420
     MLAPQKSSGR SYFLTSLLRD VVFPEQRLAG ADVKLERRRH LLRMTGVAAM TLVTVGLIAG       480
     WGYSTWQNTN YLKSVEARAV PAQKSLANLP VQLQNLVEVA PVMQGIRDIW KTPENRQGDE       540
     PLSMTLGLYQ GNKLDAAARL AHQRALNDVF LPQIAKRIED QLRTAQKDNL EYTYEALKSY       600
     LMLYQPEHFD PEALKAWITL DWARSLDRGI PEEQRMALEE QLDVLIAQGP PRSPLKMDEN       660
     LVRSVRAVLA SYPLEQRVFS RLKRQRATKD IPGFSVATAA GPSAPLVFER ISGKPLTEGV       720
     PGMFTYDGYH KRFQNEVTVL TGLLAAEDPW VLGQDKGAAD RLRDVAALGA LTDRVRRLYL       780
     AEYVKQWEAL LGDVRLIRAT GLDKNIEAAR ILSGVSSPLA NFLRAVVKET TLIPADQPKD       840
     VVSKATATVA STRKGLEDLF GGDPNKPVAT GKRIESIVDD RFEPLRRLVT AAAPGQPAPI       900
     DDALKLFNEV YVYLNAVDTA VKGRTSPPPG DVAGKLKADA GRLPEPVRSM VENLSQSGAA       960
     QAQVAERGNL SQDLRPVTEF CARAIAGRYP FSPTSKRDVL PEDFGQMFGA GGLMDDFFQK      1020
     RLAALVDTST RPWRYKPVAE RGAITTQALA QFERAARIKD IFFRAGGRGP SMRLDFKPVE      1080
     MDAGITQFIL DVDGQLVKYA HGPVVPMAVQ WPGPKGSNQV RIQVSPPSTT GSSGSAVDGP      1140
     WALFRALDDG QLEAGDAPEK FFITFQIGAR KTRFEVTTNS VQHPIRLREL REFSCPEGL       1199
//

If you have problems or comments...

PBIL Back to PBIL home page