(data stored in ACNUC1104 zone)

EMBL: CP002417.PE553

CP002417.PE553       Location/Qualifiers
FT   CDS             614910..615749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34776"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H0"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0184"
FT                   /protein_id="ADU34776.1"
FT                   /translation="MNSLLPFTFRGRVSPRQATYFSLLRQRKVGKRKATLLSATLRFAA
FT                   GNLRCSRFAGSRRTRFAQTAASPDPRTAALLGAARRALGTDRPSLRSASSRAFAALGRG
FT                   APAPALPREGREKDKTCDTGPDALLLPLPGEGWDGGTTALAAQLRLIERRVPPPQPSPG
FT                   RGGSQSKPSEAMARDVFKAERSDGASESPSVCAEERSVSRIRARPCLSEASLGETPRNV
FT                   STAGCPKRSAGTQTAGSPFLCLRSFGEAKESKSPAGARPGLRPSQGKQSIQPAGASR"
     MNSLLPFTFR GRVSPRQATY FSLLRQRKVG KRKATLLSAT LRFAAGNLRC SRFAGSRRTR        60
     FAQTAASPDP RTAALLGAAR RALGTDRPSL RSASSRAFAA LGRGAPAPAL PREGREKDKT       120
     CDTGPDALLL PLPGEGWDGG TTALAAQLRL IERRVPPPQP SPGRGGSQSK PSEAMARDVF       180
     KAERSDGASE SPSVCAEERS VSRIRARPCL SEASLGETPR NVSTAGCPKR SAGTQTAGSP       240
     FLCLRSFGEA KESKSPAGAR PGLRPSQGKQ SIQPAGASR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page