(data stored in SCRATCH zone)

EMBL: CP002417.PE555

CP002417.PE555       Location/Qualifiers
FT   CDS             617750..619342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0557"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; MltA domain
FT                   protein; KEGG: vap:Vapar_0520 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34778"
FT                   /db_xref="GOA:E6V5H2"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H2"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADU34778.1"
FT                   /translation="MHTSSQSPRFTGSTLIRWAAFAAVASLAGCVNPPPAATTADTTAA
FT                   TDTSSTTSSRPASTGASVAGQARTFSTQLATYTAVSFDAMPGWSRDDFSETWPAFLGSC
FT                   KVLTGRGAEWKEVCDRAGKVDGKNRNAIRGFFESEFSAYQIRDDDRKPDGVVTGYFEPE
FT                   IAGSRTYGAPFIYPVYGQPEDMLFADARKLPAGSGTVAAKVEGRNVVVQTGLSTRDMGA
FT                   PGLYALDLSAITRDTLDRKVRMRIEGKQLLPYYTREEIETKGAPNAKVLAFVSSATALY
FT                   EMQIQGSGRIKLANGDTIRVAYAEQNGQPFRPTIAQAANGKPRSAVKVRGSSIELQLDD
FT                   GDDDDVGSVDSSVIRTRGFTLARPTASGAVVVPGRRTAGAVAGSGIKDPSYVFFKEATS
FT                   PAGGPVGAFGVPLSAGRSIAVDPRSTPLGYPVFVSTRTPGSGAPMQRLTIAQDTGGAIR
FT                   GAVRADYFFGNGQAAATNARRMKERGQLWILLPRGLAVAQAAVSSAIRTRGAAVGAGLP
FT                   QCLVPTEGQCVDD"
     MHTSSQSPRF TGSTLIRWAA FAAVASLAGC VNPPPAATTA DTTAATDTSS TTSSRPASTG        60
     ASVAGQARTF STQLATYTAV SFDAMPGWSR DDFSETWPAF LGSCKVLTGR GAEWKEVCDR       120
     AGKVDGKNRN AIRGFFESEF SAYQIRDDDR KPDGVVTGYF EPEIAGSRTY GAPFIYPVYG       180
     QPEDMLFADA RKLPAGSGTV AAKVEGRNVV VQTGLSTRDM GAPGLYALDL SAITRDTLDR       240
     KVRMRIEGKQ LLPYYTREEI ETKGAPNAKV LAFVSSATAL YEMQIQGSGR IKLANGDTIR       300
     VAYAEQNGQP FRPTIAQAAN GKPRSAVKVR GSSIELQLDD GDDDDVGSVD SSVIRTRGFT       360
     LARPTASGAV VVPGRRTAGA VAGSGIKDPS YVFFKEATSP AGGPVGAFGV PLSAGRSIAV       420
     DPRSTPLGYP VFVSTRTPGS GAPMQRLTIA QDTGGAIRGA VRADYFFGNG QAAATNARRM       480
     KERGQLWILL PRGLAVAQAA VSSAIRTRGA AVGAGLPQCL VPTEGQCVDD                  530
//

If you have problems or comments...

PBIL Back to PBIL home page