(data stored in ACNUC1104 zone)

EMBL: CP002417.PE558

CP002417.PE558       Location/Qualifiers
FT   CDS             621430..623403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0560"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: vap:Vapar_0523 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34781"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H5"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ADU34781.1"
FT                   /translation="MRALCLRLLLSLALLVSGSTAFATQRALLVGVSELVNQPQALWLQ
FT                   APRNDVMLMRDALLKQGFAPADITVLADGVSGSVLPESQAIHEALGRLLAQSKSGDFVL
FT                   LYFSGHGTRLRDSNKRYQEPDGLSENFLARDVRGTLGADSALTGDLRDADFDAWIQAFL
FT                   ARNVFVASVFDTCSANSMTRSTTDAPAIADGPPGDEVRWRGLRTAQLVGAPGPAARVAM
FT                   TRPTVTDPVPRARYVALFASESHQITPELRLPRKNRNARPQGLLTWAVVEALSRKPATW
FT                   RDLFDGVLAVYPPVIDELAQRFPTRELPSPVAEGNLDAPIFANRAQAVTTRPVWRAQRS
FT                   GDTLTLQAGQLDGLVVQQPLRVLATMDDGTVRSAEGTLAQAFNDKARMAVPAALRELSG
FT                   AALWNITPLGEPATVALRVRAEQGLPPGLSLEYPASVIAVNETDGADARWSAGRLEVLS
FT                   PMLGAGAKSAPADAAVARRRLEVLARLKWLNQLYTIARDAQFDGFDAVFEIWNGDRLVR
FT                   SGSAQQVDAKLLPLRSGERAVLNVRNTSARSVDLVIVGIDPQGAARQVYPEDPGETNRF
FT                   KRGTREAPAVKRFELPWFNAEGGRLLVLATPAAPYSAPRLFGTGAGDAVAEVRVRGALQ
FT                   PESERQTFAAMVHWAGEVSAAK"
     MRALCLRLLL SLALLVSGST AFATQRALLV GVSELVNQPQ ALWLQAPRND VMLMRDALLK        60
     QGFAPADITV LADGVSGSVL PESQAIHEAL GRLLAQSKSG DFVLLYFSGH GTRLRDSNKR       120
     YQEPDGLSEN FLARDVRGTL GADSALTGDL RDADFDAWIQ AFLARNVFVA SVFDTCSANS       180
     MTRSTTDAPA IADGPPGDEV RWRGLRTAQL VGAPGPAARV AMTRPTVTDP VPRARYVALF       240
     ASESHQITPE LRLPRKNRNA RPQGLLTWAV VEALSRKPAT WRDLFDGVLA VYPPVIDELA       300
     QRFPTRELPS PVAEGNLDAP IFANRAQAVT TRPVWRAQRS GDTLTLQAGQ LDGLVVQQPL       360
     RVLATMDDGT VRSAEGTLAQ AFNDKARMAV PAALRELSGA ALWNITPLGE PATVALRVRA       420
     EQGLPPGLSL EYPASVIAVN ETDGADARWS AGRLEVLSPM LGAGAKSAPA DAAVARRRLE       480
     VLARLKWLNQ LYTIARDAQF DGFDAVFEIW NGDRLVRSGS AQQVDAKLLP LRSGERAVLN       540
     VRNTSARSVD LVIVGIDPQG AARQVYPEDP GETNRFKRGT REAPAVKRFE LPWFNAEGGR       600
     LLVLATPAAP YSAPRLFGTG AGDAVAEVRV RGALQPESER QTFAAMVHWA GEVSAAK          657
//

If you have problems or comments...

PBIL Back to PBIL home page