(data stored in ACNUC1104 zone)

EMBL: CP002417.PE56

CP002417.PE56        Location/Qualifiers
FT   CDS             58330..59223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0056"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: vap:Vapar_0051 peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34279"
FT                   /db_xref="GOA:E6UXT5"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0051"
FT                   /protein_id="ADU34279.1"
FT                   /translation="MKFTQFPLAAIAVGALLLTGCAATDMQMGSQSAKTMATGSAAGSA
FT                   TAGESSQLERCESPLGTVSLIENQSAGWYTILTGEYRLPPTANLLRLLVQQSNCFIVVE
FT                   RGAAGMNAMTRERALQQSGEMRGGSNFGRGQMVASDYGLSPEIVFSNSDAGGIGGALGG
FT                   LVGGGRGRALAAIGGSMQTKEASALLTLIDNRSGVQVAASEGSASKTDFGAFGGLAGRS
FT                   GAGGLGGYTNTAQGKVIAAAFMDAFNQMVRSLRNYKAQTVRGQGLGGGGRLGVDGGAAP
FT                   SQTYVPPEQAPARRRK"
     MKFTQFPLAA IAVGALLLTG CAATDMQMGS QSAKTMATGS AAGSATAGES SQLERCESPL        60
     GTVSLIENQS AGWYTILTGE YRLPPTANLL RLLVQQSNCF IVVERGAAGM NAMTRERALQ       120
     QSGEMRGGSN FGRGQMVASD YGLSPEIVFS NSDAGGIGGA LGGLVGGGRG RALAAIGGSM       180
     QTKEASALLT LIDNRSGVQV AASEGSASKT DFGAFGGLAG RSGAGGLGGY TNTAQGKVIA       240
     AAFMDAFNQM VRSLRNYKAQ TVRGQGLGGG GRLGVDGGAA PSQTYVPPEQ APARRRK          297
//

If you have problems or comments...

PBIL Back to PBIL home page