(data stored in ACNUC1104 zone)

EMBL: CP002417.PE560

CP002417.PE560       Location/Qualifiers
FT   CDS             624022..624876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0562"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG:
FT                   vap:Vapar_0525 virulence protein SciE type"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34783"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H7"
FT                   /inference="protein motif:PFAM:PF07024"
FT                   /protein_id="ADU34783.1"
FT                   /translation="MATSSAELIKSADPVAALKALSDEVRAKPSDSKHRVFMAQLLCVL
FT                   GQWERALNQLTVAAELDALAVPMKQVYGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLAL
FT                   LIESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGTPFEWLADADMRLGPVLEAFVNG
FT                   KYYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRYEGSEKSEDGELQ
FT                   LARKTEWRELRPEVWAGTGQRVLGSDAGEYALMDVREILFNPVASAEAEAAPSQEGTES
FT                   AGG"
     MATSSAELIK SADPVAALKA LSDEVRAKPS DSKHRVFMAQ LLCVLGQWER ALNQLTVAAE        60
     LDALAVPMKQ VYGDAVRCEG LRAEVFAGTR TPMIFGQPDE WLALLIESLL RQGRGESELA       120
     EDLRQRAFDG APAIAGTIDG TPFEWLADAD MRLGPVLEAF VNGKYYWIPY ARLAHIKIEP       180
     PEDLRDCVWM PAHLQFENGG ETLALIPTRY EGSEKSEDGE LQLARKTEWR ELRPEVWAGT       240
     GQRVLGSDAG EYALMDVREI LFNPVASAEA EAAPSQEGTE SAGG                        284
//

If you have problems or comments...

PBIL Back to PBIL home page