(data stored in ACNUC1104 zone)

EMBL: CP002417.PE562

CP002417.PE562       Location/Qualifiers
FT   CDS             625402..627294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0564"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="KEGG: vap:Vapar_0527 type VI secretion protein,
FT                   VC_A0110 family; TIGRFAM: type VI secretion protein,
FT                   VC_A0110 family; PFAM: protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34785"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5H9"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ADU34785.1"
FT                   /translation="MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPY
FT                   VERLIEATAFLSARVNLKLDAEYPRFTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANL
FT                   ATGPKLPRGAGLRARQAVGQNTHCEFRTSSALRIWPMEVQRAQYFTYAPDLPLATHPQS
FT                   RAIRGGLRIALRATAGLKFNQIALDDLVLHLGGAEDVAWQLQECALGQPIGVMVRPLSP
FT                   TGALQGAAQSLPASAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAGL
FT                   QALLATMPVTEIELVLLFSRGDAALEKLVTAENVQLHCVPVVNLFNKRLDRVPLTEGVS
FT                   QFHLVPDRTRPQDFEVHTVTEVIGHGAPGADATAAEQPFRPFYSAFHGTRHNHPAYFTT
FT                   TREPRMLSVRQRTEGHRSSHIGSEVYMQIVDPQQAPYAATLRQLAVSAMCTNRDLPLLM
FT                   PLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPVVSQGLGWRVVDHLALNYLSISDSTPEQ
FT                   GAAALRETLMLYATHADEMRQGQVRGLLSVKSKPVARRLPLKGPIAFGRGLEVTLEVDK
FT                   DAFHGHSVFLFGAVMSRFLARHVEVNHFVETVLRVAGKGETMRWRPLCGTRQIL"
     MDPRLLNLYE QELRYFRESS SEFARAFPKI AHRLGIEGQE VADPYVERLI EATAFLSARV        60
     NLKLDAEYPR FTGHLLDIVY PNFLAPTPAM AVVSFSPDLD DANLATGPKL PRGAGLRARQ       120
     AVGQNTHCEF RTSSALRIWP MEVQRAQYFT YAPDLPLATH PQSRAIRGGL RIALRATAGL       180
     KFNQIALDDL VLHLGGAEDV AWQLQECALG QPIGVMVRPL SPTGALQGAA QSLPASAIQP       240
     VGFEDDEALL PVTATGFSGF RLLQEYFAFP QRFQFLRIAG LQALLATMPV TEIELVLLFS       300
     RGDAALEKLV TAENVQLHCV PVVNLFNKRL DRVPLTEGVS QFHLVPDRTR PQDFEVHTVT       360
     EVIGHGAPGA DATAAEQPFR PFYSAFHGTR HNHPAYFTTT REPRMLSVRQ RTEGHRSSHI       420
     GSEVYMQIVD PQQAPYAATL RQLAVSAMCT NRDLPLLMPL GRDNDFDCVD SFPVQRVRMV       480
     RGPSRPVSPV VSQGLGWRVV DHLALNYLSI SDSTPEQGAA ALRETLMLYA THADEMRQGQ       540
     VRGLLSVKSK PVARRLPLKG PIAFGRGLEV TLEVDKDAFH GHSVFLFGAV MSRFLARHVE       600
     VNHFVETVLR VAGKGETMRW RPLCGTRQIL                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page