(data stored in ACNUC1104 zone)

EMBL: CP002417.PE564

CP002417.PE564       Location/Qualifiers
FT   CDS             628337..629671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0566"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tetratricopeptide
FT                   TPR_1 repeat-containing protein; KEGG: vap:Vapar_0529
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34787"
FT                   /db_xref="GOA:E6V5I1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU34787.1"
FT                   /translation="MTTTTLGCADTAAHAAALVQAADLTKAGNLDAADELLARILEAAP
FT                   DDPDALHYQGLLRHAQGRDAESIALIGRSLTLQPAQGGAWNNLGNLLVEAGRVDDAMRA
FT                   YENSVSFASGDEAADALSNIAMLERGKGHWQAAERASRRAIELRPTSSEAWYNLSIALM
FT                   EQGRIEESVIANSRAVLLQPRNMSARSKVIRALELLRESEQAIRMYREWLAEDPGNPVV
FT                   AHLLAACEGHAPARASDGYVETLFDSYAGSFDASLEKLHYRAPELVARAVRDMFGPPAA
FT                   RIAVVDAGCGTGLCAPLLRPWASHMAGCDLSVGMLQRAEQRGGYDVLHKAELTHYLHTQ
FT                   PGRFDLVASADTLCYFGDLHEVLAAAARALRPEGGVAFTVEAMDGGPNDFRLEGSGRYR
FT                   HAAAHVEACLAAAGFDAIRIEPIVPRREAGRNVQGWLASARLFAP"
     MTTTTLGCAD TAAHAAALVQ AADLTKAGNL DAADELLARI LEAAPDDPDA LHYQGLLRHA        60
     QGRDAESIAL IGRSLTLQPA QGGAWNNLGN LLVEAGRVDD AMRAYENSVS FASGDEAADA       120
     LSNIAMLERG KGHWQAAERA SRRAIELRPT SSEAWYNLSI ALMEQGRIEE SVIANSRAVL       180
     LQPRNMSARS KVIRALELLR ESEQAIRMYR EWLAEDPGNP VVAHLLAACE GHAPARASDG       240
     YVETLFDSYA GSFDASLEKL HYRAPELVAR AVRDMFGPPA ARIAVVDAGC GTGLCAPLLR       300
     PWASHMAGCD LSVGMLQRAE QRGGYDVLHK AELTHYLHTQ PGRFDLVASA DTLCYFGDLH       360
     EVLAAAARAL RPEGGVAFTV EAMDGGPNDF RLEGSGRYRH AAAHVEACLA AAGFDAIRIE       420
     PIVPRREAGR NVQGWLASAR LFAP                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page