(data stored in SCRATCH zone)

EMBL: CP002417.PE565

CP002417.PE565       Location/Qualifiers
FT   CDS             629741..632521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0567"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="TIGRFAM: type VI secretion ATPase, ClpV1 family;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; Clp domain protein; Clp ATPase-like; KEGG:
FT                   vap:Vapar_0530 type VI secretion ATPase, ClpV1 family;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34788"
FT                   /db_xref="GOA:E6V5I2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I2"
FT                   /inference="protein motif:TFAM:TIGR03345"
FT                   /protein_id="ADU34788.1"
FT                   /translation="MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQL
FT                   LQAQDSDLHRVIQHYGLDVSVIAKDMTAALDRLPRGATAISDFSPHIENAIERAWTYAT
FT                   LQFGEAQVRTGYILVGMLKTQSLRNPLFNLSKQFEKIKVEDLADNFPKVCDASPESQMR
FT                   AQDGTGMGSGAPGEDSGAMAPAAMGKGDALKKFAVDLTEKAKKGEMDPVTGRDEEIRQI
FT                   VDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAGA
FT                   SMKGEFEQRLRQVIDEVQSSPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNL
FT                   RTIGATTWAEYKKYIEKDPALTRRFQVVQVPEPDEVKAILMLRGVASVLEKHHRVQLLD
FT                   EAIEAAVKLSHRYIPARQLPDKAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQ
FT                   EIIGREATIGIDVTKRSAQVEALLVESKLQLEALNARWQEEKGLVDRLLELRSKLRAGN
FT                   KPVDKDAGAATTPVRTEPVEVPGAASTSSARTDGDASSGSDAAPAHDRAALLAELHELQ
FT                   AKIHAVQGESPLILPSVDEQAVASVVADWTGIPVGRMVKNEVEAVLKLADTLNQRVIGQ
FT                   KHGLEMIARRIQTSRARLDNPQKPIGVFMLCGTSGVGKTETALALAEALYGGEQNIITI
FT                   NMSEFQEAHTVSTLKGAPPGYVGYGEGGILTEAVRRRPYSVVLLDEVEKAHPDVHEIFF
FT                   QVFDKGWMEDGEGRMIDFKNTIILLTTNAGSELVMSMCRDPELLPDSNALADALKAPLM
FT                   KVFPPALLGRIVTIPYYPLSPDMMKKIVRLQLGRIKKRVETNHGVPFEYTEAVIEQVVA
FT                   RCQDPESGGRVIDAILTNTVLPTISVEYLQRLASGGEIRRVALDVKDADFTYAFD"
     MSEISRTALF GKLNSLAYKA IEGATVFCKM RGNPYVELEH WFAQLLQAQD SDLHRVIQHY        60
     GLDVSVIAKD MTAALDRLPR GATAISDFSP HIENAIERAW TYATLQFGEA QVRTGYILVG       120
     MLKTQSLRNP LFNLSKQFEK IKVEDLADNF PKVCDASPES QMRAQDGTGM GSGAPGEDSG       180
     AMAPAAMGKG DALKKFAVDL TEKAKKGEMD PVTGRDEEIR QIVDILMRRR QNNPLLTGEA       240
     GVGKTAVVEG FAQRLARGDV PPQLKDVKLL TLDIGLLQAG ASMKGEFEQR LRQVIDEVQS       300
     SPTPIILFID EIHTLVGAGG AAGTGDAANL LKPALARGNL RTIGATTWAE YKKYIEKDPA       360
     LTRRFQVVQV PEPDEVKAIL MLRGVASVLE KHHRVQLLDE AIEAAVKLSH RYIPARQLPD       420
     KAVSLLDTAC ARVAVSQHAT PPEVEDCMRR IEGLTVEQEI IGREATIGID VTKRSAQVEA       480
     LLVESKLQLE ALNARWQEEK GLVDRLLELR SKLRAGNKPV DKDAGAATTP VRTEPVEVPG       540
     AASTSSARTD GDASSGSDAA PAHDRAALLA ELHELQAKIH AVQGESPLIL PSVDEQAVAS       600
     VVADWTGIPV GRMVKNEVEA VLKLADTLNQ RVIGQKHGLE MIARRIQTSR ARLDNPQKPI       660
     GVFMLCGTSG VGKTETALAL AEALYGGEQN IITINMSEFQ EAHTVSTLKG APPGYVGYGE       720
     GGILTEAVRR RPYSVVLLDE VEKAHPDVHE IFFQVFDKGW MEDGEGRMID FKNTIILLTT       780
     NAGSELVMSM CRDPELLPDS NALADALKAP LMKVFPPALL GRIVTIPYYP LSPDMMKKIV       840
     RLQLGRIKKR VETNHGVPFE YTEAVIEQVV ARCQDPESGG RVIDAILTNT VLPTISVEYL       900
     QRLASGGEIR RVALDVKDAD FTYAFD                                            926
//

If you have problems or comments...

PBIL Back to PBIL home page