(data stored in SCRATCH zone)

EMBL: CP002417.PE566

CP002417.PE566       Location/Qualifiers
FT   CDS             632573..635614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0568"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; KEGG: vap:Vapar_0531 type
FT                   VI secretion system Vgr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34789"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:E6V5I3"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ADU34789.1"
FT                   /translation="MADHEFRIETDSPAKDDLMFWRIVGHEALARPSAYELTVLSKNKA
FT                   LDAKDILGRAFDVVIEFQDKDGGKHERHCQGHAVRFVRAGHVGRHFEYRITLRSWFWLL
FT                   TKRTNSRILQDKKILEVLDAVFEDSPIKRFKKTKAGNVIGTHTPRRYCVQHQENDYQFL
FT                   SRLLEDEGIYYWFDAHDAPGTMHLSDASDLAHEKLPVDGTLRYMPSDASEARHNDISRW
FT                   ISSRQFDTGKQASRDSDFKAIKKKLGATIDVKDDHELADFEEFEFPGGYFTGDDGENRT
FT                   KLRGDELNARRDRHWALTTWPDVTAGRSFKFEGDPDGTRNGDYVIAACTFMASHPGYES
FT                   VGASMAVTQDVRTAMAEVLRDDAVNADTLQVLEDLIASTPMLNTSQPGTSAFLITAIPL
FT                   ERAYRPPRLTPRVTMPGPQTAIVVGPAGDELHVDDHGRVKVHFHWDRYDESNEKSTCWV
FT                   RVSQPWGGKGWGGYFIPRIGQEVIVDFLNGDPDRPVIVGRVYNDDQPIPYKSPTQSGFK
FT                   TRSTPGGGPANYNEIMFEDKKGEENINIHAELDMSRSVERDDSTKVDRDQSVTVKRDQT
FT                   TTVVRDRKLTVENNDTTSIQQFQKLTVGQNQDNHVVGNQTTHVDADHALLVKGNHTIDV
FT                   KGKRTDSTGGNEDRFVKGNQTIAVTGNMSQKAARMTFEAGHIEFKVTGANSINWDGGAA
FT                   PYTAAFQKYSLLSNTHINMMAVGDINQTSLGSNTTVLGANTSGYIGNNTEANLGMAQST
FT                   FLGMSTDNAVGLAMSNFLGMQIENTVAIQIISVAAIGVERKNGDLKEAPFHILKAGAGG
FT                   GGGSASPRVDKLAAAFSAVSAVWGIYTGRAGVKATFKQYEDAAVQLREAANDPACESVP
FT                   GLKGRLERMANVADARLEQGRSLAGSHFGTDAAIGAGTGAAVVGGVGGIFGPVGTVVGG
FT                   VVGGAAGAVVGGPLGAVTRAASSDAGDQSDALKPLDDGSVPPEPSPANPAPQAPAADTG
FT                   PNSSQADGPTSEPDGPNSSGSGEP"
     MADHEFRIET DSPAKDDLMF WRIVGHEALA RPSAYELTVL SKNKALDAKD ILGRAFDVVI        60
     EFQDKDGGKH ERHCQGHAVR FVRAGHVGRH FEYRITLRSW FWLLTKRTNS RILQDKKILE       120
     VLDAVFEDSP IKRFKKTKAG NVIGTHTPRR YCVQHQENDY QFLSRLLEDE GIYYWFDAHD       180
     APGTMHLSDA SDLAHEKLPV DGTLRYMPSD ASEARHNDIS RWISSRQFDT GKQASRDSDF       240
     KAIKKKLGAT IDVKDDHELA DFEEFEFPGG YFTGDDGENR TKLRGDELNA RRDRHWALTT       300
     WPDVTAGRSF KFEGDPDGTR NGDYVIAACT FMASHPGYES VGASMAVTQD VRTAMAEVLR       360
     DDAVNADTLQ VLEDLIASTP MLNTSQPGTS AFLITAIPLE RAYRPPRLTP RVTMPGPQTA       420
     IVVGPAGDEL HVDDHGRVKV HFHWDRYDES NEKSTCWVRV SQPWGGKGWG GYFIPRIGQE       480
     VIVDFLNGDP DRPVIVGRVY NDDQPIPYKS PTQSGFKTRS TPGGGPANYN EIMFEDKKGE       540
     ENINIHAELD MSRSVERDDS TKVDRDQSVT VKRDQTTTVV RDRKLTVENN DTTSIQQFQK       600
     LTVGQNQDNH VVGNQTTHVD ADHALLVKGN HTIDVKGKRT DSTGGNEDRF VKGNQTIAVT       660
     GNMSQKAARM TFEAGHIEFK VTGANSINWD GGAAPYTAAF QKYSLLSNTH INMMAVGDIN       720
     QTSLGSNTTV LGANTSGYIG NNTEANLGMA QSTFLGMSTD NAVGLAMSNF LGMQIENTVA       780
     IQIISVAAIG VERKNGDLKE APFHILKAGA GGGGGSASPR VDKLAAAFSA VSAVWGIYTG       840
     RAGVKATFKQ YEDAAVQLRE AANDPACESV PGLKGRLERM ANVADARLEQ GRSLAGSHFG       900
     TDAAIGAGTG AAVVGGVGGI FGPVGTVVGG VVGGAAGAVV GGPLGAVTRA ASSDAGDQSD       960
     ALKPLDDGSV PPEPSPANPA PQAPAADTGP NSSQADGPTS EPDGPNSSGS GEP             1013
//

If you have problems or comments...

PBIL Back to PBIL home page