(data stored in ACNUC1104 zone)

EMBL: CP002417.PE57

CP002417.PE57        Location/Qualifiers
FT   CDS             complement(59307..60731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0057"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   vap:Vapar_0052 FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34280"
FT                   /db_xref="GOA:E6UXT6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXT6"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADU34280.1"
FT                   /translation="MNAPTQTSHLMPALHLRDVPASLIDGLKARFGANCSTAMAVRTQH
FT                   GRDESSFDAPPPSAVVFAESTQDVADAVKLASEHSVPVIPFGVGSSLEGHLLAVQGGIS
FT                   IDVSRMNKVLSINADDLTVTVQPGVTRKQLNEEIKSTGLFFPIDPGADASIGGMTATRA
FT                   SGTNAVRYGTMRENVLALEVVTAAGEVIRTGTRAKKSSAGYDLTRLMVGSEGTLGVVTE
FT                   VTLRIYPLPEAVSAAICSFPSIEAAVRTTIETIQLGVPIARVELIDVNTVRMVNAYAKL
FT                   NLREEPMLLMEFHGSPAGVKEQAETVQELASGHGGNAFEWASTPEERTRLWTARHNSYF
FT                   AAVQSRPGCRVISTDTCVPISRLADCLLDSVAEADASGIPYFLVGHVGDGNFHFGYLLD
FT                   PNVPEERVKAEALNHALVTRALALEGTCTGEHGVGLHKMDFLVTEAGVGAIDMMRTIKR
FT                   ALDPKNIMNPGKIFSL"
     MNAPTQTSHL MPALHLRDVP ASLIDGLKAR FGANCSTAMA VRTQHGRDES SFDAPPPSAV        60
     VFAESTQDVA DAVKLASEHS VPVIPFGVGS SLEGHLLAVQ GGISIDVSRM NKVLSINADD       120
     LTVTVQPGVT RKQLNEEIKS TGLFFPIDPG ADASIGGMTA TRASGTNAVR YGTMRENVLA       180
     LEVVTAAGEV IRTGTRAKKS SAGYDLTRLM VGSEGTLGVV TEVTLRIYPL PEAVSAAICS       240
     FPSIEAAVRT TIETIQLGVP IARVELIDVN TVRMVNAYAK LNLREEPMLL MEFHGSPAGV       300
     KEQAETVQEL ASGHGGNAFE WASTPEERTR LWTARHNSYF AAVQSRPGCR VISTDTCVPI       360
     SRLADCLLDS VAEADASGIP YFLVGHVGDG NFHFGYLLDP NVPEERVKAE ALNHALVTRA       420
     LALEGTCTGE HGVGLHKMDF LVTEAGVGAI DMMRTIKRAL DPKNIMNPGK IFSL             474
//

If you have problems or comments...

PBIL Back to PBIL home page